CAZyme Information: MGYG000000650_00242

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster
• CAZyme ID: MGYG000000650_00242
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000000650_4|CGC1	29109.82	6.8111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000650	2883736	MAG	Germany	Europe

• Gene Location: Start: 23599; End: 24381 Strand: +

Full Sequence      

MEQTVREREGQYYVEADRAVLSGGVYANRLSATQLHKDGQLRGTFRSYTMLLTGDQIRME
HVTVANEAGPGKQAGQAIALYADGDGLIADHCRFLGHQDTLFLAPLPPKEIQKNGFLGPG
QFTPRHKRTMYFSHCLIEGGVDFIFGGATAYFDHCEFRSVEPGYVFAPSTPEGTKEGFVC
RDCKFTCAPGLEAESCYLGRPWRDFAKVRLENCWLGEHIKKEGWHDWNKPQAHASTEFIE
IGSKGPGAVDARRPDWVTFR

Enzyme Prediction     

No EC number prediction in MGYG000000650_00242.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	37	256	1.2e-59	0.6631944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.73e-53	43	252	177	381	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.45e-34	44	256	76	274	Pectinesterase.
PLN02773	PLN02773	7.57e-34	43	256	90	278	pectinesterase
PRK10531	PRK10531	1.06e-31	43	202	194	347	putative acyl-CoA thioester hydrolase.
PLN02217	PLN02217	1.80e-28	5	256	282	524	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	3.18e-82	15	257	56	296
QRP39805.1	3.40e-81	9	257	69	324
ASN95501.1	3.40e-81	9	257	69	324
QIX89293.1	4.67e-81	23	259	74	325
ANU50094.1	9.35e-81	23	259	74	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.04e-25	20	259	57	280	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	2.17e-23	46	250	90	282	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.17e-23	46	250	90	282	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.00e-17	21	260	62	285	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	5.98e-17	23	248	90	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.04e-29	43	256	90	278	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
B0Y9F9	3.42e-26	46	253	115	296	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
Q4WBT5	3.42e-26	46	253	115	296	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
A1DBT4	1.78e-25	28	253	97	296	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
Q5MFV6	2.38e-25	44	257	353	553	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000650_00242.