CAZyme Information: MGYG000000650_00330

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster
• CAZyme ID: MGYG000000650_00330
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000000650_5|CGC2	26283.02	4.8976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000650	2883736	MAG	Germany	Europe

• Gene Location: Start: 46819; End: 47532 Strand: +

Full Sequence      

MKAGKAVKWILICVLTVMVGVGAGVMAEGYGMYRRAMEEVSLEDKVASIRGKENYTAFDE
LPEIYVDAVLSVEDHRFYNHGGIDLIAIARAVVNDIKAGAFVEGGSTVTQQLAKNMYFSQ
EKEMSRKVAEVFVAFDLEKHYTKNEILELYVNTIYYGDGYDCVKEASIGYFGKEPGDMTD
YESTLLAGIPNAPSCYAPTKNPELAAKRQKQVVNRLVTCGYFTEERAMETIAVGSRN

Enzyme Prediction     

No EC number prediction in MGYG000000650_00330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	216	3.5e-59	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.59e-76	55	217	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.38e-70	55	231	4	180	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.88e-64	32	225	58	249	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.51e-59	5	232	3	246	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	7.13e-44	56	230	61	234	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU22158.1	6.28e-129	1	235	1	235
QRP41835.1	2.44e-126	1	235	1	235
ASN93505.1	2.44e-126	1	235	1	235
ANU46909.1	2.32e-124	1	235	1	235
QQQ98385.1	2.32e-124	1	235	1	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.98e-44	52	231	19	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.91e-44	52	231	19	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.01e-36	58	226	44	212	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	3.80e-33	44	232	48	242	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.18e-33	44	232	12	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	3.97e-40	44	228	57	242	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	5.75e-40	52	231	62	241	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87626	9.87e-40	41	223	54	238	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
O87579	3.44e-39	41	217	54	232	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
O86088	5.66e-38	41	217	54	232	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.646251	0.338601	0.009015	0.001008	0.000685	0.004438

TMHMM  Annotations     

start	end
7	29