CAZyme Information: MGYG000000651_01292

Basic Information

• Species: CAG-170 sp002404795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-170; CAG-170 sp002404795
• CAZyme ID: MGYG000000651_01292
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255		29544.84	8.9058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000651	2239520	MAG	Germany	Europe

• Gene Location: Start: 9576; End: 10343 Strand: -

Full Sequence      

MKRLGFNMLRKHIKIEPMRWYYHCDRLGMLVWQDMPSGGGQYNLLTISAPLITGIHLKDS
HYRLFARTDPDGRDSFRQELEEMIRQLQNCPCIVLWVPFNEGWGQFDAKQITRLVRKLDP
TRLIDHASGWHDQGVSDVRSLHVYFKPYRFRPDKKGRAVVLSEFGGYNLPVAGHTWNEKN
FGYKGYQTPEALGEAVRKLYETQIIPARKAGLAADVYTQLSDVEDEVNGFVTYDRRVEKL
PEALMQAIARELKGE

Enzyme Prediction     

No EC number prediction in MGYG000000651_01292.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.58e-11	1	124	330	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.61e-08	1	148	45	181	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	2.91e-04	1	122	322	443	beta-D-glucuronidase; Provisional
PRK10340	ebgA	0.001	1	140	364	487	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH43755.1	1.92e-107	2	248	319	565
ACZ86262.1	9.55e-105	1	255	328	584
QKW37630.1	7.42e-104	1	254	326	579
ADU07015.1	4.39e-103	1	252	326	580
SCG46038.1	5.87e-103	1	253	329	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.50e-49	2	242	344	572	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000651_01292.