CAZyme Information: MGYG000000652_00707

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_00707
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000000652_4|CGC3	89156.16	6.965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 129692; End: 132001 Strand: -

Full Sequence      

MNKILKTFAACFIGLLPVAIFAKTSEAEQVRKIIDKVNQHWQAENKPEVRSFWDNAAYHT
GNMEAYFLTGNETYRAYSEAWAKHNEWKGAKSNDRSQWKYSYGESDEYVLFGDYQICFQT
YADLYNLAPEDYKIKRAREVMEYQMSTPQNDYWWWSDGLYMVMPVMTKLYKITHNSLYLD
KLYEYITYSDQIMFDKEENLYYRDAKYVYPKHKSVNGKKDFWARGDGWVLAGLAKVLKDL
PADYKHRAFFVEKFQKLAKAVAAIQQPEGYWTRSMMDPEHAPGPETSGTAFFTYGILWGI
NNGYLDEAEYLPIVNKAWNYLSKTALQKNGAVGYVQPIGEKAIPGQVVDANSTANFGVGA
FLLAACEYVRYLEAPKTQDRAYWCDLAYKMAAPILSNMSKGELQKNMIVEVSPTWDGRDK
RVTYMEAFGRLMAGIAPWLTLPDDNTAEGAMRKQLREWALKSYANAVDPQSPDYLLWRKE
GQPLVDAAYIAESFLRAFDQLWKPLDDTTKQRYIEEFTLLRRIDPPYTNWLLFSSTIESF
LAKAGAPYDAYRINSAIRKVEEWYTGDGWYADGPSFAFDYYSSYVFHPMYLETLQAMKDV
KAYTRIHYSKYYDRALHRAQKYSLILERFISPEGTFPVFGRSIPYRMATMQPLALMAWYQ
ELPAGVTNAQVRCALTAVMRRMFASGNNFNEGGYLTIGFSGRQPNIADWYTNNGSLYMTS
LAFLPLGLPASHPFWTDAPQDWTSKRAWSEQPFPKDHHWKDEIRTWDLF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	379	740	1.5e-108	0.9942528735632183
GH105	44	370	9.7e-81	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	5.19e-163	379	742	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	3.03e-97	30	372	6	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	1.56e-71	421	743	52	368	Uncharacterized protein [Function unknown].
COG4225	YesR	1.22e-36	61	370	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36172.1	0.0	1	769	1	770
AND21736.1	0.0	1	769	1	771
AII65647.1	0.0	1	769	1	771
QQY40390.1	0.0	1	769	1	771
ABR38224.1	0.0	1	769	2	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.80e-200	1	374	1	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	4.53e-169	24	373	10	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.31e-53	53	370	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.13e-14	18	367	8	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3K11_A	4.23e-14	155	396	200	441	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	8.60e-53	53	370	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.54e-51	53	373	58	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.90e-39	153	367	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	6.19e-14	18	367	8	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000343	0.998889	0.000218	0.000187	0.000180	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_00707.