CAZyme Information: MGYG000000652_01412

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_01412
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		29274.98	6.9517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 30864; End: 31640 Strand: -

Full Sequence      

MAMKRVINFLCLLLVWAAASSQEVFLRKDYISDRGDTLRYRLLEPETLEPGAKYPLVLFL
HGAGERGTDNEKQLKHGAQMWLNPVNREQYPAFVLMPQCPPDDYWAYIGRPASLQPSDMP
VDVPLSPLLRTLKELLDTWLAKPEIDKSRIYIMGLSMGGMGTYDLAIRHPDLFAAAIPIC
GTVNPARFTPALKQVKFRIFHGDADNVVPVEGSRAAYRALKELGVDVKYTEFPGCMHESW
NPAFNLPDFMSWLFEQKK

Enzyme Prediction     

No EC number prediction in MGYG000000652_01412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	36	243	5.9e-30	0.9118942731277533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	5.80e-56	35	257	171	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	2.21e-17	27	238	367	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG3509	LpqC	1.98e-15	35	212	44	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	1.19e-14	40	238	8	189	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	1.08e-13	45	241	4	203	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	3.95e-50	15	257	801	1042
ABS60377.1	4.85e-50	38	258	22	245
QDU56037.1	2.16e-34	54	258	819	1007
VTR91196.1	7.52e-32	40	258	45	239
QJW99051.1	1.00e-31	40	258	46	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	4.10e-53	33	258	153	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	4.74e-27	34	258	17	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	2.41e-13	31	258	44	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
5DWD_A	3.27e-07	51	237	38	222	Crystalstructure of esterase PE8 [Pelagibacterium halotolerans B2],5DWD_B Crystal structure of esterase PE8 [Pelagibacterium halotolerans B2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3UFF7	1.37e-08	57	238	25	213	Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3
D4AR77	4.09e-06	35	250	385	616	Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06907 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999175	0.000151	0.000144	0.000134	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_01412.