CAZyme Information: MGYG000000652_01934

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_01934
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MGYG000000652_18|CGC1	89293.11	6.1596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 5697; End: 8033 Strand: -

Full Sequence      

MLKDLKLFMAFVLTILVGNLSANQDFVVNSQKILKISCLETEAPVVHTALQILTHDWQDV
FGVKPQMCLFDGDLIVGTWESSLIRQTGIDVSMLRGKHEAFLLTVSPKGRLIIAGSDKRG
TAYGIMELSRLIGVSPWEWWADVIPEPRKEFALPASYKDLQEPSVDFRGIFINDEDWGLT
PWSGLTYEPTPVKGQIGPKTHARIFELLLRLRANTFWPAMHECSVPFYFTKGNKEIADKY
GIYIGTSHCEPMMRNTNGEWKRDGIGEYDYVNNSEHVRTFWEERVKEVAGYDNLYTLGMR
GVHDGAMKGAKTVNEQKQVLERVLKDQRSLLASYVDKTVANIPQVFIPYKEVLDVYNAGL
EIPDDVTLMWCDDNYGYIRHFPTAAEKARKGGNGIYYHISYWGRPHDYLWLCTVQPGLIY
QQMTQAYERGIRKMWVLNVGDIKPGEYQIELFLDMAWDIGEVKKQGVTKHLYRFLEREFG
QSVATQTLPVLLEHYRLAYIRKPEFMGATRTEEKDPKYKVITDLPWSETYIRERILSYQQ
LSDQVEKISSEVAESRKDAFFQLIKYPVQAASQMNFKLLGAQLARHGKGDWSRSDMAYDS
IVSLTQLYNTGKWNHIMDCSPRRLPVFDRVQPSSSIENMLEESEILFQWNGTDCIENHPV
ICEGIGYEGKAVSLDQGQQLSFDFEYQSADSLVFEVCLLPNHPVEGEKLRFELSLDGGEG
IVCSYQTKGRSEEWKMNVLRNQAIRRVVLKPQATVNHRLKFKALDEGVVLDQIKVFTN

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	28	773	6e-234	0.9899569583931134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	161	505	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.72e-10	663	773	31	156	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR73815.1	0.0	3	777	4	779
QJR69482.1	0.0	3	777	4	779
QJR65219.1	0.0	3	777	4	779
AII66357.1	0.0	3	777	4	779
QJR61058.1	0.0	3	777	4	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	0.0	24	776	18	774	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	1.41e-99	83	615	82	608	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	7.55e-99	53	617	72	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	7.71e-99	40	617	31	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	1.10e-98	40	617	32	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000200	0.999251	0.000142	0.000139	0.000128	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_01934.