CAZyme Information: MGYG000000652_01971

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_01971
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		84205.63	5.8927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 62186; End: 64408 Strand: -

Full Sequence      

MKTIFSIVFAFLCAIVCSAQVLTLPASEAVSPGMWICYRMDLRLEDEPSDVELRVAADSK
YWLWVNGELQVREGGLKRGPNPKDTYCDVLRGSQGLREGDNTVAVLVWYFGKDGFSHRNS
PTPGLAFHLSVDGKVLDTDKAWKVCRHPAYYLPEGEEPNYRLPESNIGFDAAKDIAFQQP
DYDDSSWSKVRRVSLEEAGWNRLVDRPIPQWKDYGLKTYTRTERQGNQILAYLPYNAQVT
PYLKVKSVAGRKIDIRTDDYRGGSATNVFAEYITREGVQEFECRGWMNGHYVIYTIPEGC
EVLELKYRETGYDTNFAGSFWCDDPFLTRLWTKSQRTLYITMRDTYMDCPDRERAQWWGD
VVNELGEAFYALDEKAHRLTRKGICELMDWQRADSTIFAPVPAGNYKDELPMQMLASVGY
YGFWTYYMGTGDKELIEYVFPRVKKYIHVWKTSPDGLVIPRKGGWTWGDWGDNKDMGLLF
SLWYSIALDGYAHMARLVDEPAEARWADETNDRLRQVFHQKYWTGAYYKSPDYEGQPDDR
AQALAVVAGVLPKELYPTIRPFFRQQYHASPYMEKYVLQALCEMGYYQDAMDRMRLRYEA
MVDSPLTTLWEGWGIGKEGFGGGSYNHAWSGGPLTILSSYVAGVKVVEPGFKVFSVCPNL
GNLSHVKVTVPLAGGRFIEADVKKDAGRCVLELAVPEGTAGLVGLPDGYTQMRVNGKPAE
AGMKLKTGVWKIEFGNLPSK

Enzyme Prediction     

No EC number prediction in MGYG000000652_01971.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	250	703	4.2e-85	0.9365079365079365
CBM67	29	194	9.7e-27	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.04e-31	317	641	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.11e-05	47	198	2	158	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.42e-04	643	708	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	4.02e-04	424	529	109	217	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL36670.1	0.0	19	734	22	738
QDH54696.1	0.0	19	734	22	738
QLG44645.1	2.63e-262	25	717	31	729
QUT48047.1	3.12e-258	35	708	40	717
AGY53286.1	1.36e-255	19	717	28	734

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000696	0.997255	0.001362	0.000227	0.000208	0.000213

TMHMM  Annotations     

start	end
5	24