CAZyme Information: MGYG000000652_02297

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_02297
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285	MGYG000000652_26|CGC1	31849.48	4.2183

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 25179; End: 26036 Strand: +

Full Sequence      

MKKISYLLLLLLAFVYAGCADTEQPYVGYVVIERAVVEAEASSTTTITADTDIDSPIEIK
SIDFGEGVDEWCTITTKGKEITVTTTQANTGSNYRTATVNVKCGYWLKSFQVLQKYAGQE
YLQYDWTRWTATGNSVESSDGGGYASLFSEDRTTYWHSQYNGDAPSLPYWIVVDMQEELE
IAKFDIGRRYYAGNGNNYGSVKTLKLYASTDNENFTEVGGFTFTFPWTAPDGTVVEGPNS
PLIPAYEEIVPAEPVKARYMKMEITETNTSNDACQIAYFKAYEKI

Enzyme Prediction     

No EC number prediction in MGYG000000652_02297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	136	279	2e-17	0.9274193548387096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	3.04e-14	130	277	1	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	2.22e-07	135	264	15	141	Substituted updates: Jan 31, 2002
cd14948	BACON	7.84e-04	69	115	34	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
smart00231	FA58C	0.004	154	264	34	136	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.
pfam13004	BACON	0.005	61	115	1	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO21431.1	3.47e-117	1	285	5	286
QIL39112.1	8.47e-11	115	266	172	301
AZU64122.1	1.15e-09	108	283	1198	1357
AIM35717.1	1.43e-09	125	282	317	454
BCA48665.1	1.69e-09	120	273	242	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2KD7_A	2.47e-11	135	224	21	106	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3GGL_A	1.98e-10	135	224	31	116	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
3F2Z_A	7.99e-10	118	224	2	106	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_02297.