CAZyme Information: MGYG000000653_00437

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_00437
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		90022.57	7.2253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 121626; End: 123980 Strand: -

Full Sequence      

MKINKIYLLLPAFLTIAISAEAQLPDKVKCFPVSQVRLTESPFKNAQDLDICYLLGLNPD
RLLAPYRKEAGLPPKATNYGNWENSGLDGHIGGHYLSALSYMYAATGNQEIKERLDYVLN
ELEDCQEASGDGYLCGVPGGKNMWEEISHGNIRASRFDLNGKWVPLYNIHKIYAGLRDAY
IQTGSRKAKKMLVKLTDWMLRLVSSLSNTQIQEMLNSEHGGLNETFADVAYITGDNRYLE
LAHRFSHQEILQPLLKHQDLLTGMHANTQIPKIIGFKRIADVEGNRDWNDAAHYFWETVV
EHRSISIGGNSVREHFNPADDFSSMLSNEQGPETCNTYNMLRLTKMLYETSADVKLVDYY
ERALYNHILSSQNPVQGGFVYFTPMRPGHYRVYSQPQTSFWCCVGSGLENHAKYGEMIYG
YNDKSLYVNLFIPSTLQWGNTEIIQQTHFPEEEGTTIIVRPRNGKKKFTLCLRLPGWTKQ
EELHLSVNDIPQKIMIKDGYIYLTRTWSKNDKVRLNLPMHLYSVGLPDKSPNYSFLYGPV
VLAAQLGKQGQDGLFADDSRGGHIANGKRLPLQNMPIIVGDTSHILSHIKKDGSKPLTFK
LTGIYPDKYDEMILQPFYRLYECRYMVYWPILSEKELQTHISLLTEKEKRRAALDSITTD
KVICGEQQPENDHFIQMEKSRIGDDEGTHWRETNNWFSYRMKTGEESANKVYILFRPEFR
RDARIEINGKEVGKLTDRRQLSDVSVAEFDIPEPLRFQNELTVKICKGNEKVTPHIYEIR
LICR

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	35	543	5.7e-209	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	35	543	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.83e-124	26	548	7	506	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.08e-41	547	629	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND18452.1	0.0	1	782	1	781
AII66677.1	0.0	1	782	1	781
QJR69771.1	0.0	1	782	1	781
QJR74104.1	0.0	1	782	1	781
QJR53846.1	0.0	1	782	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.23e-272	14	782	10	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.63e-261	14	782	10	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	3.11e-25	95	519	82	532	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.91e-23	95	518	82	531	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.999040	0.000195	0.000166	0.000156	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_00437.