CAZyme Information: MGYG000000653_01023

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_01023
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	MGYG000000653_6|CGC2	53223.69	6.0258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 37758; End: 39137 Strand: +

Full Sequence      

MKKLIFSAIGILLYLSATAQMPERTPENIQKYKEICRKYIYKDMKGMYREAGGALKYPFL
APGSSQYLDMLWDWDSWLSNIALRQILLENGSDKDRREALRYEQGCVLNSLNYGGMDGWI
PIWIERNAPSREEMLKTRNPWKSNMHKPTLAQHAAFIVENMNGDAEWLRDDFYALQAFVS
KYLNFHRHKATGLMYWETDEAIGVDNDPSTFYRPHGSSGSIFLNALMYKELLAMNYLADC
LNMPDIARYFANEAETLKKNIREHCWDRRDGFYYSVDLNLLPVEKPDIESLQPGTLYLHV
GQPRTYDCLIQRLSVWSGFMSMWAGIATPEQAKEMVQRHFHDTLSYNAPAGIRTLSPLEK
MYDTRASGNPSSWQGPVWINVNYLVFRGLVQYGYTEEARELAEKTILLLGRDYERFGALH
EYYLPDNGEPVLNKGFQNWNLLVLNMAAWLDGKEVISEF

Enzyme Prediction     

No EC number prediction in MGYG000000653_01023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	30	444	2.6e-22	0.4280701754385965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01204	Trehalase	1.55e-14	203	436	284	494	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	4.98e-14	117	448	126	493	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	7.25e-12	220	404	577	738	alpha-glucosidase; Provisional
COG3408	GDB1	2.21e-10	153	419	346	581	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	1.78e-05	223	423	356	517	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL66706.1	7.66e-27	32	445	284	666
QEZ67778.1	5.36e-22	28	440	244	654
AYN06686.1	1.72e-21	27	440	258	652
QYE96607.1	2.42e-21	31	440	282	692
QRH01833.1	3.32e-21	48	450	297	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	3.56e-09	82	448	395	776	Murineendoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7T66_A	1.10e-08	226	448	611	812	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]
4WVA_A	1.68e-08	263	440	274	411	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	9.17e-08	263	440	274	411	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q80UM7	4.93e-09	82	448	450	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
D8QTR2	1.47e-08	22	450	61	485	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.95e-08	34	450	72	485	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
O14255	1.96e-08	148	448	533	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
O88941	1.99e-08	348	448	721	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999068	0.000177	0.000159	0.000153	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_01023.