CAZyme Information: MGYG000000653_01761

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_01761
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
957	MGYG000000653_13|CGC1	103910.42	4.4118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 18531; End: 21404 Strand: +

Full Sequence      

MKRILLTFCMAFACLAGAVADELIAFPGAEGYGRFARGARAGENPTVYHVTNLNDSGKGS
LRDAVSQPNRIVVFDVAGVIRIKSPLVFSKNLTIAGQTAPGSGIVIYGERTSFSGASDII
VRYLRIRMGMSGRGQNDAAGIANGSNMIFDHCSISWGKDETFSINSDGKNGGVGNITIQK
TIMSQGLLPHSAGGLCQPTNTVGGVTLYRNLYADNNTRNHKVKGLNQYINNVVYNWGSGG
GYNLGGDSEGRIWADVQSNYFIQGPNSGGNGVGSGNQLTTVYQRGNKTDMSRDGVLNGRD
MDENDFARATRVDSFEDLLQSEEYPSEHPHAPIASMSMTAEEAYQWVVDSVGACLPDRDE
VDEYVIDELRSLGNKGVIISSESVLGLVNGVGNIYNAPKPLDTDNDGMPDEWEKANGLDP
NDATDAVKVAANGYLNIENYINSIPASPVPFLKYPVEILAKSLGTDSITVAFECHEKATG
AKIRVEVMPEGGEYTTVETIGTDVTSYTVKGLSEKTNYTLRFTTFTDDMASLPAEFSFRT
KGAPGEPDLSTDPIPANGETIAEYTTVTLKFSNEVTGRPYYYVYVGTSPDRLDSVATVRS
RSYTMDVEPNTTYYWRIDVENTYGRTQGEVWNFTTGQEPVRTKVAYFAFDETSGSTAVNV
PTSEEIMANDATPYGSYVPVWGEGKINGAILFDATNTTDGMIVPSYEEIVFESAPFSYEL
WFKSTAGNSSQSRYLLHKGSHKSDGDRNTGKWFGLEYKKGTLYFGVDDDVTKSLAEVSAT
SYFDGNWHHVVAVRDVENAKLLLYIDGELKASANDATGAIDGSEALVIGNVNVNFDSPFI
GSIDEFTLYNDALTELEIKSKYEHGVTAIEEIAAQEREDVVVYPNPFKDRFTVTLPQSTG
TVKVEIYSLSGALVYSNDLTVSGGMVEVKGLDDLPAGVYNCAVIADDTTRTARMMKY

Enzyme Prediction     

No EC number prediction in MGYG000000653_01761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	77	261	1.3e-49	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13385	Laminin_G_3	4.39e-19	697	859	3	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
TIGR04183	Por_Secre_tail	1.49e-09	882	956	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
smart00560	LamGL	7.34e-09	761	854	37	131	LamG-like jellyroll fold domain.
pfam18962	Por_Secre_tail	5.05e-07	882	951	1	67	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
smart00282	LamG	6.20e-06	745	850	19	131	Laminin G domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73817.1	1.64e-272	14	956	14	972
QDH80543.1	2.23e-181	10	931	18	914
AGA79623.1	1.16e-180	22	931	33	914
ANF52864.1	7.53e-173	22	947	30	989
AYN02029.1	2.53e-170	16	897	24	938

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	7.27e-110	21	447	18	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q0CLG7	1.51e-108	21	447	18	416	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
A1DPF0	4.28e-108	23	447	21	417	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q2UB83	1.14e-107	21	447	18	416	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q4WL88	3.23e-107	23	447	21	417	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999080	0.000203	0.000150	0.000146	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_01761.