CAZyme Information: MGYG000000653_01770

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_01770
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000000653_13|CGC1	52793.54	7.5177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 34501; End: 35934 Strand: +

Full Sequence      

MKKNLFLLCAFLVPALISAQISSKDAWKQASKLEKSIEKTSFPKRTYNITDFGAKPDMPE
APCHDAINLAIVTCNQAGGGTVIVPKGTFYTGPITLKSNVNFHLEEGAVLKFDTNPELYM
PAVLTRWEGVDCYNMRPLIYAYGETNLAITGKGVIDGQGSMETWWPMCGAKKYGWKEGMI
GQNCGGRAKLLAWGESGEPIYKRLMTVQDGMRPQLVNLYRCDRVLVEGVTMQNSPFWTLH
PLFCTNLIVRGVHFINRGPNGDGCDPESCDGVIIENCVFDTGDDCIAIKSGRNRDGRTWG
VPSQNIIVRNCKMYDGHGGVVIGSEISGGYKNLYVENCEMDSPNLDRVIRIKTSNCRGGV
IENVFVRNIKVGVCREAVLRINLQYENREICDRNFPPTVRNVLCENITCEGSNLGVYYVG
LEGSDNVYNIQVDNCEFNNVKKGSTSPEDGIFIKGGVKDVRFNNLKINGQIVKSPAL

Enzyme Prediction     

EC	3.2.1.67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	73	411	8.1e-80	0.8307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	6.00e-93	36	455	72	468	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	6.24e-24	74	446	1	309	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	1.03e-15	5	471	10	426	polygalacturonase ADPG
PLN02188	PLN02188	5.45e-12	46	370	36	311	polygalacturonase/glycoside hydrolase family protein
PLN02793	PLN02793	1.69e-10	44	371	50	327	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90781.1	4.83e-253	1	473	1	467
ALJ58201.1	4.83e-253	1	473	1	467
QDO70927.1	3.95e-252	1	473	1	467
QUT76979.1	1.58e-249	1	473	1	467
QNL41176.1	3.65e-246	4	473	7	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.86e-109	30	428	7	399	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	9.87e-85	42	442	40	430	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	6.29e-25	39	472	149	606	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MXN_A	1.33e-11	38	316	13	240	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	4.26e-33	6	377	22	364	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.85e-27	216	385	25	196	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P15922	1.96e-23	40	465	146	573	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P58598	5.50e-17	65	464	74	491	Polygalacturonase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=pglA PE=3 SV=1
P35339	1.92e-13	3	412	9	355	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG2C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000583	0.998685	0.000218	0.000172	0.000159	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_01770.