CAZyme Information: MGYG000000653_01991

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_01991
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000000653_17|CGC1	57404.49	8.1039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 26696; End: 28237 Strand: +

Full Sequence      

MKKLFLFALCLTLTHLSWAKTYDIKKLGADATGKKACTELINKTIDKAAREGGGTIYFPA
GTYLTATIEMKSNITLHIESGATIRFSDNFEDYLPFVKIRWEGTVMNTLSPLIYAHDADN
LTITGRGTLDGNGFKWWTWEGETKKIIKDNGGKLPDDKKSKLQRMWEEANVGLEVSDYYK
GSLERRMFRPPFIQFFECTNILIENIKIINSPFWTVNPAFCDNVVVHGVTIKNPDKNPKG
PNTDGINPTSCRNVRISDCFISVGDDCITIKSGRDADGRKYGKACENITITNCIMLSGHG
GVVIGSEMSGGVKRVTISNCVFDGTDAGIRLKASRGRGGVVEQIRVDNIVMRNIQRNAFI
FDLFYDKTSKVEPVSERTPIFRNIHLSNITGREIKQIGYISGIEEMPVQNISFNNLNMEA
EKGFVVNTAKDIYFNNVEFSATKGSPWVFEKSEKIILNNVRTKYPTEGTPVITFDHVTDA
YINNCVQIEPVSSFYRETDSQVKDGGNNQISIK

Enzyme Prediction     

No EC number prediction in MGYG000000653_01991.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	49	437	1.7e-97	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.24e-93	22	355	83	399	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	8.99e-37	119	391	54	275	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	9.19e-27	14	427	60	417	polygalacturonase ADPG
PLN02793	PLN02793	2.88e-25	56	423	88	399	Probable polygalacturonase
PLN02188	PLN02188	3.99e-24	21	430	36	386	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM11326.1	3.05e-300	1	507	1	505
QUT78461.1	3.05e-300	1	507	1	505
QRQ55309.1	2.50e-299	1	507	1	505
ALJ48472.1	2.50e-299	1	507	1	505
SCV07882.1	2.50e-299	1	507	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	4.18e-82	23	422	29	414	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.47e-65	20	440	43	449	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	2.34e-32	23	455	158	599	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	1.71e-26	19	421	3	364	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
1IA5_A	3.22e-15	62	369	24	274	PolygalacturonaseFrom Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	7.48e-49	45	475	89	479	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	2.12e-32	198	403	30	241	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P15922	1.63e-28	12	449	142	587	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P18192	2.13e-26	19	421	29	390	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P26509	9.84e-26	17	421	24	390	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000299	0.998842	0.000241	0.000201	0.000200	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_01991.