CAZyme Information: MGYG000000653_02035

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_02035
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000000653_18|CGC1	42490.1	8.9176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 36042; End: 37172 Strand: -

Full Sequence      

MKYYLIAGEASGDLHAANLMRAIRECDPQAEFRFWGGDAMQQVGGTLVRHYREMAYMGFV
QVALHLRQVLKNITLCKNDLAAYRPDVLILVDYPGFNLKIARYAKEQLHLPVHYYISPKI
WAWKEYRIKEIKRYVDRMYSILPFEVDFYRKHGYAIDYVGNPTVDELHGRADADETFGHF
TTENRLSDKPIIALLPGSRLAEIKDNLSIMISAASSFPDYQIVIAGAPGVPPRFYDPYLR
QGKISIVFGKTYRLLQQSHAALVTSGTATLETALLRVPQVVGYFMRGGQFTYSLFRPFIK
VDYISLVNLIADAPVVKELLVHHFSVENARRALEPLLGETPERAAMLNGYDEVAVRLGSP
GAPQRAARLIVESLSA

Enzyme Prediction     

No EC number prediction in MGYG000000653_02035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	1.9e-111	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.55e-110	1	374	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.06e-103	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.36e-76	4	320	2	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.49e-69	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.35e-51	1	328	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12800.1	5.27e-178	1	374	1	373
BCI64292.1	4.20e-176	1	375	1	375
QRO23865.1	5.02e-160	1	375	1	375
QDO69124.1	2.96e-154	1	374	1	376
BBK92630.1	5.76e-154	1	374	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.92e-44	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.11e-43	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.66e-67	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	5.28e-65	5	367	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.00e-61	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2IL69	7.56e-61	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	1.06e-60	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_02035.