CAZyme Information: MGYG000000653_02075

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_02075
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562		62143.07	7.2441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 1321; End: 3009 Strand: -

Full Sequence      

MKRLFLLAGIVLPIAICPTQAQYPTVPDSVKQRAAQENAIHHKLSEAAWKKALKTVKKEE
KKYGRVYRPWASKPEDLPQCQIPAFPGAEGGGAFTAGGRGGKVFTVTSLEDRGPGTLREA
CESGGARIVVFNVAGVIRLKSPISIKAPYITIAGQTAPGDGVCVTGASFLIDTHDVIIRH
MRFRRGAVDVADRDDALGGNAVGNIILDHISASWGLDEVMSIYRHVWNRDETGKGTKLPT
VNITIQNSMFAEALDTYNHAFGATIGGHNCYFARNLFASNISRNCSVGMNGGFNLVNSVI
YNWWNRSIDGGDEYSQFNIINNYFKPGPITALQTGRPIQHRILKPESSRDKNKPDTFGKA
YVSGNIMLGNDKVTADNWDGGVQVYGLKDCGKFENEIRVDTPFEMPIHNPILSAQDAYEF
VMENVGATLPERDSVDTRIICTVRTGQAIYDKKAKPYTTPYVKRRLPDDSYKYGIITHPE
QVGGLPEYNGTPYVDSDNDGMPDEWEKRFGLDPNDPTDAAKDCNGDGYTNIEKYINGIDP
SRKIDWTDLRNNHDTLKERLQK

Enzyme Prediction     

No EC number prediction in MGYG000000653_02075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	1.3e-62	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	4.47e-04	495	516	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	0.003	136	324	3	186	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT84043.1	3.39e-298	1	559	4	556
QJR68105.1	2.78e-297	1	559	4	556
QJR55559.1	2.78e-297	1	559	4	556
AII69027.1	2.78e-297	1	559	4	556
ALA74794.1	2.78e-297	1	559	4	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	3.83e-07	89	303	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	2.93e-55	82	541	20	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
B0XMA2	1.13e-54	82	541	21	417	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	2.19e-54	82	541	21	417	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q0CLG7	2.98e-54	84	541	22	416	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
Q4WL88	3.06e-54	82	541	21	417	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000824	0.949321	0.049005	0.000340	0.000253	0.000216

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_02075.