CAZyme Information: MGYG000000653_02199

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_02199
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1040	MGYG000000653_28|CGC1	115332.33	4.5833

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 3059; End: 6181 Strand: +

Full Sequence      

MKNKKCIILNLWIFFLISPFMVMAQMPQIETLDRGIVAVNMSKKEGQKKNGIFLSWRFLD
SDDKTTAFNVYRDGKLLTETPLTTVTNYTDTEGTTSSEYVIETLVGGKVTKRDTVKEIWP
NIYKQIPLDRPKPGITPPYSVTVGGKLEDYPNGQFYSYTPNDCSVGDVDGDGKYEIIVKW
DPTNSRDNSQRGYTGEVYLDCYKLDGQKLWRINLGKNIRAGAHYTQFMVYDLDGDGKAEV
ACKTAPGTIDGKGNYVLMNDDDPTKDYRADGKNAGIVTSGPEYLTVFNGETGAEIVTVEY
SPRRGNSKDWGKDDYFNRSERYLACIAYLDGVHPSLVMCRGYYQRTALVAYDFDGKNLTQ
RWIHDSTTDGKGAYGQGNHNLSVGDVDDDGYDEIIYGACAIDQDGKLLYRTGMGHGDAIH
FSDLDPDIDGLEVFSPHEDKSAKYGFDIHEAGTGKIIYGEFTGSDVGRGIAADIDPTSRG
FEFWSSANNNIYDCRGNVLYTGGRPSVNFRIYWDGDLQDELLDGDKIDKWNPEKKQTERI
FTPYQYSSASTCNGTKKTPCLQADLFGDWREELVLWNGSDSSSLVIFTTTYDSDYRLVTP
MHDHVYRMGIAWQNVAYNQPPHLGYYIGDGIDPTAARLVKTGEGNLVQNIEVGEQIETIS
YTWINADGVEINGRLPKGITVDIDAAQSSVTISGIPEEVGTFEYSIDTHGGTTDISLPGT
ITVRKQTVLTEVAVFHFDETSGTTAQNKISGEAAAHDLTPTWTNGVKGNAISFPGIRGYM
AQSHYDALNMSTGSFSIALWFKSAGADNIDWYLFHKGSHTANASIGATGKWIGIQYKNNN
LTFGIDDNVTKTNLDVAASDYFDNEWHFLTCVRDSANRQIIMYIDGEVVGSKADGTGNIF
ETEDMVIGNCNVNFNTPFQGAIDELVIYTGALSAVKVRNLYEEQRPSGAIDATTMSVTQR
VKVYPTTFSDQITVTLDGLESENVTFIIHSASGMEMYNRSYLAEKHSPLTISGLNEWPNG
LYTLTVITSEGTFTRKLIKE

Enzyme Prediction     

EC	4.2.2.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	28	635	1.8e-253	0.9862778730703259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	29	625	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	7.42e-31	28	119	2	86	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
pfam13385	Laminin_G_3	2.78e-17	789	934	13	147	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
TIGR04183	Por_Secre_tail	5.75e-05	963	1040	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
smart00560	LamGL	1.18e-04	793	935	1	133	LamG-like jellyroll fold domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73808.1	0.0	9	1039	4	1026
QCD43243.1	2.18e-275	28	938	18	911
QCP71313.1	6.50e-264	28	944	29	959
SCV07134.1	6.07e-241	28	632	28	625
QRQ54635.1	6.07e-241	28	632	28	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	4.85e-221	28	631	4	572	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	9.21e-220	21	631	3	579	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	4.31e-210	28	631	7	593	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	7.30e-220	28	631	41	609	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	1.79e-209	28	631	7	593	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000558	0.998642	0.000231	0.000192	0.000161	0.000159

TMHMM  Annotations     

start	end
7	29