CAZyme Information: MGYG000000655_00121

Basic Information

• Species: Holdemanella sp900547815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemanella; Holdemanella sp900547815
• CAZyme ID: MGYG000000655_00121
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814		92678.45	5.0954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000655	2321148	MAG	Germany	Europe

• Gene Location: Start: 14288; End: 16732 Strand: -

Full Sequence      

MARWYRDSQNLAISFVSKCAILEIDWRLEMKRLITCLFTFVVVLGFCTQSIYATSTSVNE
TNNNSFVGFDEDGNLIQYDPEELEAEVSASNISTVLLEEDTKDVTYGVVNFRVKSSANEI
TTYTNCANGQQGYLNGYTMSDGAYLGMVNGKVKFKAAGVTGLVDPSEVQIVDYANANTIS
CYKVRKNALYHNVANIISNHADYYSKTYVGNKPASLSDNATYYSYDGHYFYADFKTMIQD
YKNGVYTNAVNSNAPYYNYFQYLPSRSKTSISAAQFDQYTLSKVSSGKLLNVGSSLVSNQ
NKYGVNALIMYSNAVLESGWGKSQIAMDKNNLFGHGAADNNPYYGANGYSSVDDCIKYHA
KVFISEGFCDPKDYNARYYGSHLGDKESGINVKYASDPYWGEKIASLCWQVQNGLSINEV
NAYTIGIANHSVSYYTNPGSNLLYTSMDFSAYPIIILGKQNGYYKVQSDATLNADRTSIT
QDSGAYDFDLYYAYISQNSVSVLGIGKWVQDENGNWYWYENNMYVKGWKQIQSKYYYFDT
NGVMLSNQWIGNYYVGQDGAMLTSQWIGDRYVDANGLWTPDHWINNGGKWWYRHQDGTYT
KNDFEVIDNQTYYFDNDGYRVTGWKQVKSDWYLFNGSGVMVKNSWSGNYFLEKDGKMAKS
KWIGTFYVDANGVWQPDCWAYNGRWWYRYGDGSYPRNKFDVINNNVYYFDSNGYVVTGWQ
VINGNWYYFNGSGAMLKSQWIGNYYVGKDGIMATSSWVDNNQYYVNENGVYVAGRWVQYG
SRWCYYAGNVYAKDITLNINGKAYTFDSEGYMVE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	295	411	1.9e-23	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033838	PspC_subgroup_1	1.19e-27	527	772	487	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	2.59e-27	527	772	444	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	5.00e-24	622	785	443	614	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.01e-22	622	785	486	637	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG5263	COG5263	1.23e-19	527	780	82	303	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM11023.1	5.71e-103	106	506	137	551
QUN13370.1	1.47e-101	93	506	122	543
QEK17141.1	5.03e-95	108	506	89	494
BCL58959.1	1.64e-91	27	544	39	551
AWY97555.1	2.30e-89	70	503	52	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	1.21e-23	157	415	65	286	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
4IWT_A	5.68e-06	679	717	6	45	Crystalstructure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA [Streptococcus pneumoniae GA60080],4IWT_B Crystal structure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA [Streptococcus pneumoniae GA60080]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	6.94e-22	157	415	433	654	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	7.80e-22	157	415	477	698	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.920828	0.078319	0.000464	0.000117	0.000090	0.000190

TMHMM  Annotations     

start	end
34	56