CAZyme Information: MGYG000000655_00138

Basic Information

• Species: Holdemanella sp900547815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemanella; Holdemanella sp900547815
• CAZyme ID: MGYG000000655_00138
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	MGYG000000655_3|CGC1	47194.4	5.4976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000655	2321148	MAG	Germany	Europe

• Gene Location: Start: 37115; End: 38338 Strand: -

Full Sequence      

MEARKIINSLQKRGLRGSIQRFRQGPQKVGLIDFWSFITDREETPFNLEDFKKHKQENQV
TLNWVIPEMGVGSGGHLNIFRFVSYLERHGVHNRIYLYRSTRFLNDSYLKDFVRKYFSIL
DENVELHHDTKSMTFADGTVATSWDTAYCVRNFNNTTSKFYFIQDFEPYFYAHGSEYEFA
EQTYKFGFRGITAGDWLKDICIHEYNMKADSFSFSYDKGLYTVKQKQDEIKRVFFYARPV
TPRRDFELGLLALNELSKKIPDLEVIFAGWDVAQYEIPFKHQNLGIMKIEELSDLYGKCD
LCLVISNTNLSLLPLEVMASGSVAVCSKGANSEWLVSEDNSILVSYDPIEIADTMYTYLN
DAAKLDEIRQKGIEFAQNTSWDVEGKKVLDAVLKGIKEDEESIDHRG

Enzyme Prediction     

No EC number prediction in MGYG000000655_00138.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	7.66e-14	62	390	5	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	1.18e-12	163	390	108	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
COG0438	RfaB	1.97e-11	227	398	195	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03800	GT4_sucrose_synthase	6.68e-05	231	382	221	390	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
cd04951	GT4_WbdM_like	9.74e-05	210	378	153	343	LPS/UnPP-GlcNAc-Gal a-1,4-glucosyltransferase WbdM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMK55186.1	2.11e-186	4	406	6	407
QYX25932.1	2.87e-170	4	401	9	406
CCI71311.1	9.32e-111	58	394	67	406
AFY64819.1	5.47e-105	4	388	23	402
ABM68323.1	1.16e-101	4	398	9	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X0E_A	9.87e-09	140	355	137	373	Complexstructure of WsaF with dTDP [Geobacillus stearothermophilus],2X0E_B Complex structure of WsaF with dTDP [Geobacillus stearothermophilus],2X0F_A Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus],2X0F_B Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus]
2X0D_A	2.32e-08	140	355	137	373	APOstructure of WsaF [Geobacillus stearothermophilus],2X0D_B APO structure of WsaF [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	5.59e-35	13	396	863	1253	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000655_00138.