CAZyme Information: MGYG000000655_00543

Basic Information

• Species: Holdemanella sp900547815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemanella; Holdemanella sp900547815
• CAZyme ID: MGYG000000655_00543
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2316	MGYG000000655_12|CGC1	254738.47	4.6351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000655	2321148	MAG	Germany	Europe

• Gene Location: Start: 16665; End: 23615 Strand: -

Full Sequence      

MKNSQKALLASMVTLSQGVTAMASPVRVFANTEPVQTKNTTVKKETANVPKNGYTFVSAP
VSEPVVENNTVTINHVNGEKTRITFLENNLFRLDMEPDGKDESFKEYATPNNSNHTGRIV
QQSDSSSEYSKPTPTVTNDAGVYTIAVKDGVSLEVSKEDATMTLKRADGSVVWQESQPVQ
YKNGSTIQTFVKNSGENFFGGGTQNGRFIHTGESINIVNENNWVSGGVASPNPFFWSTNG
YGVVRNTFKKGVYDFGKKNSNEVEATHSEKRLDAYYFVGDTPVSVLQGYFKLTGNPALFP
EEAFYLGHLNCYNRDEWVEGGSTPLETVNDKVKYSEKNNGGQIKQGGVLESLNGTNETDY
KFSARAVIDQYEKYDMQLGWFLPNDGYGCGYGTDDANLDNNIANLKSFTDYANSKGVGTG
LWTQSSLTPDPNQPVHLQRDFEKEVYNGGIRTLKTDVAWVGSGYDFGLDGINKAYNIISK
AETKNRPTIVTLDGWAGTQRYGGIWTGDQTGGNWEYIRFQIPTYIGQSLSGNPNVSSDVD
GIFGGSSTIQARDIQWKTFTTMLLDMDGWGSYPKKPYVFGDETSSINRMYLKLRSQLMPY
IYSTAYTSANLGEGSEKGKPQVRAMFLEFPEDANTYSKNMQYQFMFGKDFLVAPVYQNTA
ADKDGNDIRNGIYLPDSNQVWIDYFTGKQYRGGTTLNNFDAPIWKMPLFVKNGAIIPMFE
AHNNAAAKTETNKGGVDKSKRLVEFYPDKESEYTQYEDEGNTVDNSNLEEVNYGSNVTTH
YTSSVKDGKAVLRAEASQGSYNGYDANKETTFIVNVSKKPTALTGKVGSSKVELKEVKSQ
EEFDSATGNVYFYNKEPNLNKFATEGSEFEKTEIKTTPKLYVKFEKTNVSSNGIELTVDG
FVNDGNLDKDELNENLQTPANFKADEENITPTTIPLKWDAVSDATEYEVETDGMIQSGIT
ETSYTHTDLEYHSKHTYRVRSRNKDGYSKWSDPIEVESALDPYRNVPKDIKVSWDYGDAW
GKLSNILDFDYGTFFHSTNSVTEDQGLIYDLKKVYDLERIDYTPRNDNKGNGTVQRMDVY
TSIDGVNWTLSYDSSKQKSDWTYSKDMSDLDTKTIDMTGTSARYIKYVVKKSKGGFFSAA
ELQPYIVDGSEGYVIGDTNNDGVIDENDATQIENYVGLEDGDPTWDQVKRSDYNKNGYYD
AQDITQTMVHLDGGVKTPSKDPKGSLITSLDKTDYAAGETVTLTISGVDMKNVYSIGGKI
GYNSDDLTFKGTSATLATANMREYKFDRIAYKKSENNAAVNRNINFTYTNSGSKKSISGT
KDVVTVTFTAKRDISLTPDYFNASEYMFVSNNLNAINPTVASEDIKTPDVTVSQIKVQSV
QGQDESVLQSGMGVDKLIDGKWGADANRFEFKWGNNGDEVPARVPYWVLFNFDGQKTITD
MTIRVRVDGTNINTGALKDFELYAVNGEEETKLGNYSITAVDSKQGFNIHFDAPVQAEKI
KLNALNSQGGLKYKLNIDEVEFYQNEATYAEDIVFDENNASTIGVGQLKAFKATVLPENV
TNGLYSVESDKPEVVSVIRTVDGDHYNYTLHAKKQGKAVLTITSNSTNKEGKKITKTFEI
NVVAGQVVVDDLKAQLDEANKAIENKNLYTTASIDALKAAVKTAEAVLKDKDATQTEVNA
QTINLFKAIQALEYKGSNEGQPDCETEITIDPEKVTATSEATIDGDIIKNAFDGDENTIW
HSNYNGQHTLPQGVTMDLGAEYDVQQLNYLPRPGSGNGDITKYMVETSLDGEKFKTVVVG
TFEHDGSMLVNKGEFKKVKFDVTKARYVRFTALESLGNELNTYASAAEIKLFGTLHKEAI
PATSITLDKTELTLNVNEIAQVKATLSPTETTDVVTWSSEDESIAKVDATGKITAVANGT
VNIIAKANDQVQATVTVTVNAPGQAQLQQLIDEANKVKYENVVLQDALTKAIAKATDALN
GDEQELQMAYYELAAEMSDLELIQNNLDELNGFVQMDDSLYVKDDALTLFKNKVEIAKNL
MADPINKKELLKPQIKDLSDTYKLLTKLNREKLTAAIELAERVKTQDCVDNEELAAFNAA
LEAAKAADPANNEEIDALVNALLDAQANLKYKQNGLTTQDQRDSIQYALDILKGLNLEDY
SKEDQETIKAAIAKGEEALANPELDRDDANKVIKQLVKALAVKPNAPTTPDKPGTGSGTE
TKPGTGSGTETKPGTGSGTETKPGTGSGSTTTKPGSGTTTTVNPSKGQSNANTGVENKAG
LFGSLGVGAASLAGIATILYRKRENGKGLKKVKNKK

Enzyme Prediction     

No EC number prediction in MGYG000000655_00543.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	470	716	1.2e-59	0.531615925058548
CBM32	1717	1849	2e-24	0.9274193548387096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	6.98e-165	292	687	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	2.85e-69	144	827	104	767	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.75e-65	275	716	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	1.32e-41	477	720	204	430	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06589	GH31	1.90e-35	353	591	15	265	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK23937.1	0.0	28	2218	27	2210
QJA02122.1	0.0	38	2211	38	2231
BCT46261.1	0.0	69	1883	55	1921
QBJ76643.1	0.0	1	1960	1	1888
SLK21224.1	0.0	1	1960	1	1888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	6.10e-268	55	1004	35	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	3.27e-267	55	1004	35	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	8.95e-267	55	1004	35	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
4LKS_A	2.81e-33	1713	1853	27	166	Structureof CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LKS_C Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LQR_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124],4P5Y_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with N-acetylgalactosamine [Clostridium perfringens ATCC 13124]
6JR6_A	2.02e-31	183	820	143	781	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9P999	4.55e-33	233	762	153	660	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9F234	7.80e-29	196	762	147	713	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9FN05	4.30e-28	272	760	332	818	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
Q8TET4	2.88e-27	272	718	331	781	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3
Q9BE70	1.41e-26	474	718	408	636	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000765	0.998106	0.000426	0.000290	0.000205	0.000168

TMHMM  Annotations     

start	end
2279	2301