CAZyme Information: MGYG000000656_00041

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000000656_00041
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		43303.87	9.6083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000656	1593882	MAG	Germany	Europe

• Gene Location: Start: 39193; End: 40302 Strand: -

Full Sequence      

MKILVVNPILYTSETARIKKINTIKDTMIYNMCLAFKKCGHEPTLIAASEYKPIKDEKYD
FEIIFLDTKLQKIFKPNCFPWLKGFKKYIKKESKNYDLIISSEVFSMSSLCVSIYQKKRT
VIWHELAKHNNILKKIPSIIWYNIIARICFKNTRIVPRSKNAYDFISKYCNNVSDEYIDH
GVDLEEFNLISKKRKKQFVVLSQLIKRKRIDGIIDVFADFVKKMDNEYVLYIIGIGDEEK
KLKEKAKAYGLEEKIIFTGFMTHEEMKPILGTSQAMIINTEKDNNMVSIVESLALGTPII
TTDIPYNVDYIKRYKLGVVKEKLSYSDLKEIVDNNLLYVNNCINYREKISNEYHVKQFIQ
EYKKVIGEK

Enzyme Prediction     

No EC number prediction in MGYG000000656_00041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	330	3.3e-22	0.8625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	8.38e-27	27	366	18	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	7.75e-23	34	368	28	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	1.74e-18	27	364	16	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03794	GT4_WbuB-like	4.50e-17	2	363	1	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
pfam00534	Glycos_transf_1	7.36e-16	195	333	2	139	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK90020.1	1.41e-126	1	360	1	359
QBE98771.1	3.29e-126	1	359	1	358
AFL79244.1	8.22e-100	1	366	1	367
QNL41364.1	2.14e-92	28	360	1	334
AHF12043.1	2.12e-83	1	350	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC2_A	1.68e-09	88	306	210	426	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC1_A	6.59e-07	182	306	318	430	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC1_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC3_A	6.59e-07	182	306	318	430	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC7_A	1.16e-06	182	306	317	429	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC7_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58469	1.30e-10	76	365	76	386	Uncharacterized glycosyltransferase MJ1069 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1069 PE=3 SV=1
Q8CWR6	8.40e-10	27	319	19	330	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1
O05083	8.64e-09	31	366	23	353	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000656_00041.