CAZyme Information: MGYG000000657_00320

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_00320
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		85472.09	6.3343

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 8841; End: 11192 Strand: +

Full Sequence      

MIRRSLSAVFALLVTTPLLAAPAGQQTLFNFVRPADVVQVATTDAILPQYNAEQTAEGEV
LRRVTFNPAVAPSLRLTPQTGVWDWSQSGMMTLRIQNAMNWALTLDVTVQSSNGKTLTSR
VDLPAGPAQTLLLPLKANSPHSQGMRAGPPMPMTLDGQRILLASSQGEIDLSQVVSVSLS
IAQPNVAQSILLERFGVQDGTGVIKAVYGAIVDGYGQSTRAKWPERVANDEQLKAAAAKE
QQQLKGWLAGRADQDKYGGWLKGAGFEATGFFRTEKRNGRWNLITPEGHPFYSLGLNAVT
ANDSQTYVAGREWMFTDLPHDGTPLASFYGKANNNSGNASTQGRGFDAGRWYNFYAANLQ
RIYGEPCVTAKTEPDSAPVSPCAPPAFDAKRWQARTLDRLQAWGFNTIGNWSDPELGLND
RVPYTLPLSIVGDYTSISTGTDWWGGMPDPFDPRFAMATERAVAIAARDHRDDPWLIGYF
ADNELAWAGPGNDPKSRYALALGTLRMTTDVPAKRAFLKQLRDKYRNQQGLSKAWGIEIP
AWELMEDPGFEGPLPNTEHPQIEADYQYFQKVFADTYFKTISDSLKWHAPNHLLLGGRFA
VSTPEAVASCAKYCDVLSFNFYTLQPQDGYDFGKLRELDKPVMITEFNFGSRDRGPFWGG
VTEVANEEARGPAYSKFLKQAVAEPSIVGVHWFQYLDQPVTGRLLDGENGHFGMIGITDL
PFTGFVDSVRKANLQALGQLGQEAAKAQAEAEKAVKAPVHATDDGSGGRSGAGHAGGHSG
KGH

Enzyme Prediction     

No EC number prediction in MGYG000000657_00320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	77	735	9.1e-269	0.9800918836140888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17992	Agarase_CBM	2.46e-10	73	182	42	152	Agarase CBM like domain. This is the N-terminal CBM-like domain in exo-beta-agarase proteins (EC:3.2.1.81) found in the marine microbe Saccharophagus degradans. This enzyme catalyzes a critical step in the metabolism of agarose by S. degradans through cleaving agarose oligomers into neoagarobiose products that can be further processed into monomers. The CBM-like domain is structurally very similar to some CBM families. A loop in the CBM-like domain is involved in forming the roof of the active site channel. The contribution of the CBM-like domain to formation of the active site of the enzyme supports a role in substrate recognition explaining the exo-mode of beta-agarase action.
pfam02449	Glyco_hydro_42	0.001	464	658	118	294	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPL30772.1	0.0	1	783	1	783
SDU62850.1	0.0	1	783	1	783
ARQ73663.1	0.0	1	783	1	783
QPC34815.1	0.0	1	783	1	783
ASC88188.1	0.0	1	783	1	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	2.91e-115	83	733	62	739	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	8.02e-115	83	733	62	739	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	5.04e-105	73	733	78	755	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	1.22e-98	83	733	81	755	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5T3B_A	2.18e-14	255	733	84	469	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.53e-112	83	733	290	945	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	6.28e-73	26	738	214	914	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000367	0.998876	0.000205	0.000198	0.000178	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000657_00320.