CAZyme Information: MGYG000000657_00579

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_00579
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000000657_18|CGC1	95816.98	7.6047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 8696; End: 11248 Strand: +

Full Sequence      

MSNAQPHPASLSEYLAHLPLSDEQRAELANCTSFAELHARLSAQSDVDAAEAAQASVGTR
LNLTSAAELEEAEMLALDASGRVMLKATPPIRRTKVVPEPWRTNILVRGWRRLTGRSNPP
KPEIDERVLPKARWRTVGSIRRYILLVLMLGQTIVAGWYMKGIMPYQGWSFVDLEEVLHQ
PLMQTAQQVLPYALQTSILILFGILFCWVSAGFWTALMGFLELLTGHDKYRISGASAGNE
PIPEQARTALVMPICNEDVTRVFAGLRATYESVAVTGDLDRFDFFVLSDSNDPDICVAEQ
QAWLDVCRETEGFGRIFYRRRRRRVKRKSGNLDDFCRRWGGDYKYMVVLDADSVMSGECL
TSLVRLMEATPDAGIIQTAPRASGMDTLYARMQQFATRVYGPLFTAGLHFWQLGESHYWG
HNAIIRMKPFIEHCALAPLPGKGAFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEEL
PPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFFFLLLSTA
LLAVNTLMEPQYFLEPRQLYPLWPQWHPEKAVALFSTTIVLLFLPKLLSIILIWAKGAKE
FGGKFKVTLSMLLEMLFSVLLAPVRMIFHTRFVLAAFLGWAATWNSPQRDDDSTPWSEAV
RRHGPQTLLGAAWAALVLWLNPSFLWWLVPIVGSLMLSIPVSVISSRVKLGLKTRDESLF
LIPEEYAPPRELSATAEYTHENRYHALHDGFVRAVVDPQQNALACALATSRHREAEPIEW
LRTERVRHALKVGPEGVTNNERMQLLSDPVALARLHALVWSEGHEGWLNAWRESVAADPH
APLLPLQPAA

Enzyme Prediction     

No EC number prediction in MGYG000000657_00579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	250	432	6.8e-24	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	61	832	1	734	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	79	720	1	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	8.28e-153	248	501	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
pfam00535	Glycos_transf_2	1.69e-14	251	430	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	5.73e-14	196	646	7	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ76629.1	0.0	1	850	1	850
QPL32030.1	0.0	1	850	1	850
SDU46270.1	0.0	1	850	1	850
QPC36122.1	0.0	1	850	1	850
ASC87000.1	0.0	1	850	1	850

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48PK6	0.0	1	848	1	850	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=opgH PE=3 SV=1
Q6D6A7	0.0	13	840	9	851	Glucans biosynthesis glucosyltransferase H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mdoH PE=3 SV=1
Q4ZZH4	0.0	1	848	1	850	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=opgH PE=3 SV=1
Q4KJM5	0.0	1	848	1	848	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=opgH PE=3 SV=1
Q87UY1	0.0	1	848	1	849	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
143	160
199	221
522	544
572	594
607	629
683	705