CAZyme Information: MGYG000000657_00852

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_00852
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
168		17937.56	10.7322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 18834; End: 19340 Strand: +

Full Sequence      

MLAGVLLDLSMTASLTSSLNVGQKVLSNIGRVTPLHKQRVEQAGFMVLKSPDIPSILVET
GFISNSNEASKLASSSHQQALARSISSGVRQFFQQNPPPGTYIAWLRDTGKIAQGAREHT
VRPGETLAMIAVRYQVGVATLRSSNSLKTDELKVGQNLNIPATALAAQ

Enzyme Prediction     

No EC number prediction in MGYG000000657_00852.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0860	AmiC	1.06e-26	11	96	146	231	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
PRK10431	PRK10431	7.24e-25	2	101	325	428	N-acetylmuramoyl-l-alanine amidase II; Provisional
PRK10319	PRK10319	2.70e-23	2	99	185	287	N-acetylmuramoyl-L-alanine amidase AmiA.
smart00646	Ami_3	1.00e-22	9	89	33	113	Ami_3 domain.
cd02696	MurNAc-LAA	4.25e-22	14	89	96	171	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIE35153.1	1.92e-106	1	168	302	469
SDU08580.1	2.22e-106	1	168	307	474
QPL32169.1	1.71e-104	1	168	302	469
ASC88819.1	1.71e-104	1	168	302	469
QPC36260.1	1.71e-104	1	168	302	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BIN_A	1.95e-20	8	93	308	393	Crystalstructure of the E. coli N-acetylmuramoyl-L-alanine amidase AmiC [Escherichia coli K-12]
3NE8_A	1.78e-08	2	92	132	223	Thecrystal structure of a domain from N-acetylmuramoyl-l-alanine amidase of Bartonella henselae str. Houston-1 [Bartonella henselae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P63883	1.15e-19	8	93	322	407	N-acetylmuramoyl-L-alanine amidase AmiC OS=Escherichia coli (strain K12) OX=83333 GN=amiC PE=1 SV=1
P63884	1.15e-19	8	93	322	407	N-acetylmuramoyl-L-alanine amidase AmiC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=amiC PE=3 SV=1
Q9K0V3	7.05e-18	6	92	321	407	N-acetylmuramoyl-L-alanine amidase AmiC OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=amiC PE=1 SV=1
P26365	2.42e-16	2	97	325	420	N-acetylmuramoyl-L-alanine amidase AmiB OS=Escherichia coli (strain K12) OX=83333 GN=amiB PE=1 SV=2
P26366	8.29e-16	2	97	319	414	N-acetylmuramoyl-L-alanine amidase AmiB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=amiB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997718	0.002267	0.000012	0.000006	0.000003	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000657_00852.