CAZyme Information: MGYG000000657_01553

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_01553
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		28264.36	10.3061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 5554; End: 6309 Strand: +

Full Sequence      

MARSTGSAKSSMLRFLVHRFLKVLLWFAVGSALLVLVFRWVPLPGTALMVERKVESWLDG
QPIDLQRSWRPWDEISDELKVAVMAGEDQKFPEHWGFDFGAIRAALIHNEQGGTLRGAST
LSQQVSKNLFLWSGRSWLRKGLEAWFTALIEVLWPKQRILEVYLNSAEWDEGVFGAEAAA
QHHFGVSAKNLTRQQASYLAAVLPSPLNWSASHPSTYVSRRAGWIRQQMSQLGGDSYLTT
LNNSRKAPWAG

Enzyme Prediction     

No EC number prediction in MGYG000000657_01553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	66	229	1.7e-48	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.06e-130	9	238	1	232	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.38e-103	14	235	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.55e-78	12	236	20	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.00e-60	59	229	1	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.59e-36	12	239	1	237	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU54406.1	8.05e-180	1	250	1	250
SDU28026.1	5.01e-174	1	250	1	250
QIE31524.1	5.01e-174	1	250	1	250
QPL33849.1	3.21e-172	12	250	1	239
QPC37986.1	3.21e-172	12	250	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.33e-23	73	231	26	186	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.60e-23	73	231	26	186	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	8.66e-20	74	221	34	183	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.21e-19	74	221	43	192	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
4OON_A	2.63e-18	43	233	12	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3K584	2.22e-148	12	250	1	239	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mtgA PE=3 SV=1
C3K3M0	1.01e-144	12	250	1	239	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=mtgA PE=3 SV=1
Q4K4C2	2.26e-141	12	250	1	239	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mtgA PE=3 SV=1
Q48CL6	8.47e-136	12	246	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=mtgA PE=3 SV=1
Q88AF9	2.42e-135	12	246	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42