CAZyme Information: MGYG000000657_02248

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_02248
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193		20960.8	9.8761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 4974; End: 5555 Strand: +

Full Sequence      

MSRYQIVGTNRIAAFIAQVGHESGHLTRLVENLNYSADGLANTWPNRYAEPDGKGGYVKV
MVKDRSRNKPNALGLSLAGKPEQIANNVYAGRMGNTAPGDGWKYRGRGLIQLTGKTNYHL
CGEALGLDLHAQPELLEKPQHACMAAAWFWGSNGLNSLADKGDLETITRRINGGLTGLAD
RQTLYARALKVLA

Enzyme Prediction     

No EC number prediction in MGYG000000657_02248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	9	152	8.1e-37	0.42857142857142855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.87e-70	1	193	31	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	8.26e-11	12	192	49	214	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.88e-09	12	192	53	222	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJI30731.1	3.94e-88	1	192	30	226
ARQ75185.1	1.82e-85	1	193	30	201
SDE71131.1	7.37e-85	1	193	30	201
SDG46733.1	2.00e-82	1	193	30	201
QHF03354.1	1.13e-74	1	192	30	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	4.31e-48	1	193	43	223	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
3W3E_A	9.15e-07	12	175	58	201	Structureof Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata],3W3E_B Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata]
4MST_A	9.15e-07	97	150	103	155	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]
1WVU_A	1.38e-06	104	175	152	231	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	1.38e-06	104	175	152	231	ChainA, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	1.88e-32	13	191	41	196	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	7.07e-14	82	191	237	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
O24658	8.52e-09	97	187	156	248	Endochitinase At2g43590 OS=Arabidopsis thaliana OX=3702 GN=At2g43590 PE=2 SV=1
Q06209	1.05e-07	97	187	160	252	Basic endochitinase CHB4 OS=Brassica napus OX=3708 PE=1 SV=2
Q10S66	6.26e-07	104	150	121	168	Chitinase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000657_02248.