CAZyme Information: MGYG000000657_04035

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_04035
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		58001.8	9.7015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 1106; End: 2632 Strand: -

Full Sequence      

MTLIKRWNSEQKGLLVLLAVSALLLLLGLGSRELWGPETRWANIALQMLQSGDYLDPYLK
GSPYYDKPLPSYWLITATASLMGGLGNWSLRLSSVIAAWLSVWLVYLLGEQLFRKGTGLI
AGWMLATTFYFVFWARVATADILTVFGLLAAVWWYWRGPDDTRLSRYCVFFLLLSLTSLL
KGLIGFILPGLVLLPHLLSEQRWKRHLNLRLLLALVVAGAVYMLPFVLSHLYGAPTYGES
GLELVLRENVVRFFNPFDHMGPIYTYLIYLPAYTLPWAPFWMIGLWMAVRQWRHIEPNTR
WLVWGLGLLFVFFTASGSRRSYYVLPLVPLAQLLAAWWVTRRMAQGKTNPRRWNIGFGMS
TTLLLLVLGVFYPWSNGGGGVIQFGQDVKARASQQAPWDQWRMVMIDVDNKLPMYVQNEG
EPFFYIDQSQDYPRDGDSAGLMAWLDKTSGQHFNPQRTLIFAQYRSGDPLPLGYLSMDHQ
TLTSQPDNGDRLLHKREGGSVVYIPQLP

Enzyme Prediction     

No EC number prediction in MGYG000000657_04035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	9	389	2.7e-81	0.6796296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.21e-28	38	354	35	351	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.10e-16	32	347	26	341	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.54e-11	66	193	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.37e-04	36	166	30	162	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX27697.1	1.78e-50	21	336	3	316
AIH03481.1	2.48e-38	9	339	2	328
AEH23071.1	1.73e-35	8	371	2	356
QER41589.1	2.58e-33	8	372	2	357
ACH39987.1	2.54e-32	8	373	13	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.37e-19	7	354	27	373	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WAM1	1.89e-29	8	374	2	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
A6V1N8	4.70e-25	8	366	2	358	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
Q4ZSZ0	2.06e-24	8	367	3	360	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q3KCB9	6.64e-24	9	347	2	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
Q02R27	8.90e-24	9	366	2	358	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999924	0.000023	0.000004	0.000000	0.000000	0.000084

TMHMM  Annotations     

start	end
13	35
87	109
130	152
172	194
207	229
267	289
301	318
322	340
353	375