CAZyme Information: MGYG000000657_04171

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_04171
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		46919.23	9.9111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 880; End: 2100 Strand: -

Full Sequence      

MSDAVGLGLRRLARQDPEKAASLLDTYATNMHFSRDEKVAIAREIGLTFARRYDSRGLDI
MTQYDPELRDNTVTEWRLRLLLRLGRWEDAYQLTRKLPQDLATTSRWRYWQARSLELAEP
KNPQAQVLFKKVANERDFYGFLAADRAQTPYQLNNRPLVLSPQLIKKVRNTPGVQRALEF
HDRGQVVDGRREWYYVSRLFSRDEMVAQAKLAYDLKWYFPAIRTISQAQYWDDLDIRFPM
AHRDTLVREAKLRGLHSSWVFAITRQESAFMDDARSGVGASGLMQLMPATAKETARKFSI
PLASPQQVLNPDKNIQLGAAYLSQVHGQFNGNRVLASAAYNAGPGRVRQWLKGANHLGFD
VWIESIPFDETRQYVQNVLSYSVIYGQKLNAPQPVVDWHERYFDDQ

Enzyme Prediction     

No EC number prediction in MGYG000000657_04171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	258	382	2.8e-29	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.10e-78	237	385	1	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK11619	PRK11619	1.75e-74	3	402	243	644	lytic murein transglycosylase; Provisional
cd16896	LT_Slt70-like	3.92e-49	239	381	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.52e-40	105	394	1	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	5.50e-36	258	381	2	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU66469.1	8.17e-299	1	406	237	642
ARQ73957.1	8.17e-299	1	406	237	642
QPC34515.1	8.17e-299	1	406	237	642
QPL30476.1	8.17e-299	1	406	237	642
ASC88472.1	2.34e-298	1	406	237	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OHU_A	8.19e-234	2	405	238	641	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	8.54e-234	2	405	209	612	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	8.84e-234	2	405	210	613	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	1.79e-232	2	403	209	610	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	5.00e-60	12	402	225	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	3.09e-59	12	402	252	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	4.30e-59	12	402	252	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.30e-59	12	402	252	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	8.33e-44	3	396	198	583	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	7.00e-16	244	380	61	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000657_04171.