CAZyme Information: MGYG000000658_00050

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000000658_00050
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000000658_1|CGC3	81343.09	6.5102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000658	1755704	MAG	Germany	Europe

• Gene Location: Start: 58114; End: 60336 Strand: +

Full Sequence      

MKPILLCLAFAIGLSASGQQKPAYLDENRPLEERVEDALSRMTLQEKINIIHAQSKFSSP
GVPRLGIPEVWATDGPHGIRIEMKWDEWDQAGWTSDSVVAFPALSCLAATWNPQMSLLYG
RSIGEEARYRGKDILLGPGVNIYRTPLNGRNFEYMGEDPYLASRMVVPYIIGVQENGVAA
CVKHFAVNNHEVNRHNTNVIVDDRTLYEIYLPAFKAAVQEGNAWSIMGGYNLYMGQHCCQ
NKRLLQDILKGEWGFKGAVVSDWGAVHNTEQSIAHGVDLEFGSWTNGLSDGKGNAYDNYF
LVTPYLRLIQQGKVGTKELDDKVRRVLRLIFRTCMNTRAGWGALCSPAHYAAARRIDEEG
IVLLKNERNLLPLDLSKAKRIVVVGENAIKAMTIGGGSSSLKVQHETSPLEGLRQRIGDT
VRIDYVRGYVGDTNNEYNNVRTGADLTESRSAEELKAEALTAAKGADYVIFVGGLNKSGG
QDCEDADRSGLNLPYGQDELISALAAVNQNLIVVNISGNAVAMPWIKSVPAIVQGWYGGS
EAGNALAAILTGDTNPSGKLPFTFPVKLEDVPAHKLGEYVGQGRNDTVDIHYNEGIFVGY
RWTDLHQEARPLFPFGHGLSYTTFAYGKPTVDHSSISATDSLTIKVAIRNTGTRAGQEVV
QLYIRDKEASVPRPDKELKGFQKIQLSPGEEKVVQFTIGSDALSYFDAERHKWVAEPGTF
EAVIGASSSDIRGTVKFRLK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	280	1.6e-67	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.39e-121	1	732	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	2.66e-75	3	698	7	742	Probable beta-xylosidase; Provisional
COG1472	BglX	1.82e-74	60	422	53	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.69e-69	361	600	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.76e-36	40	329	44	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI79977.1	0.0	1	740	1	741
QPH58875.1	0.0	1	740	1	741
QBJ18570.1	0.0	1	740	1	741
QUU01284.1	0.0	1	740	1	741
QUT37276.1	0.0	1	740	1	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.32e-157	35	731	5	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.54e-117	31	731	1	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.57e-114	33	732	2	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	4.88e-114	34	734	53	823	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3AC0_A	3.81e-113	35	740	6	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	7.02e-293	1	737	6	743	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.27e-156	35	731	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BFG8	2.49e-135	34	740	10	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	9.25e-131	35	739	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
F6C6C1	6.99e-118	31	740	1	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999131	0.000161	0.000139	0.000133	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000658_00050.