CAZyme Information: MGYG000000658_00321

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000000658_00321
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1118		123758.92	6.0025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000658	1755704	MAG	Germany	Europe

• Gene Location: Start: 4959; End: 8315 Strand: -

Full Sequence      

MPLAALASLLTCAPLRAQGQTMHVVAEDDCGEAGRQPHLVMGEDYTFSAPEGTDPAALTC
NFGPRVIYAFDHLNKEADYELELTFYSDGNRLVEVQADGNPVCEPVRLAEGELATRRVRL
PRKAYAYGQLVLVFECSGGPNAVISGIRLRSADATPLAPFAEEARAELRQMPAFVVDTLV
NAEAFLPQYTPKPSAVAGTYRAALSLDGVWQFSPSESGDTWHDIQVPGEWAMQGFQADSA
GWARYRRTFDLPSDWAGQRVKLRFDGVHSEYEVFLNGKRAGYHLGGMTPYELDVTDALHP
GTNEVALRVRSESLADMLGSLTQYAAHQMGGITRKVTLFAVPKAYVADLRYVTDLDADYR
DATLRVFARVCNTTGKALTDAALQIRVEEHGATLRAKLPTVKADSTWQGWLSLPVSAPRL
WDNEHPNLYTVTASLSAGGKQVEDVTRRVGFREVAVQGNRLLVNGRAVKLRGVCRHEVHP
LLGRSLTPEWWRRDAELYRAANCNFVRTSHYPPAEEFIEACDELGLFVELEAPVCWVGHG
TNENWRRLNYRDPQYYDYILQANLETVHFYRNHPAVLFWSLANESYWNKGFAQVAEYVRR
ADPSRPYSFHDQAYGGFNNQGSTAPIANIHYPGPGGCEAAARDGRPMTFGEFCHLNAYNR
SELVTDPGVRCDWALALTPMWEQMFRTPAVLGGSIWSGIDDVFQLPDGSAVGYGEWGPID
GWRRPKPEYWYMKKAYSPVRVLADSLAVGVAPRIGVENRLTFSNLNELRADWRMGAASGT
ATVSAEPGGRGELRLDAVPAAGDTLFLSFTDPKGYVVDEYALPAGHSPALSLPTVEPAAT
KLRERKDRYVVTGDGFECEISKADGSLLSVSRDGVQLLSGGPTLMALPLTGGGCLPNHNA
HTPPFNATCSAWKATAVTARRDGDDVLVSVEGSYAEFEGGYTLRINAAGTLVADYDFQAL
QDVNPRQWGLVFDAPRSFDRVYWRRKGLWSVYPADHIGRTAGEAPLFFDAVPAGATGRTR
PSWSWSMDANELGSNDFRSTRRDFYYAGLRDSAGRRVTACGDGRQHWRSWLEDGHIRFLV
ADFDSPGNEMFLESYYAPFRRPVRKGDHISGTVRLRLE

Enzyme Prediction     

No EC number prediction in MGYG000000658_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	199	993	5e-135	0.9547872340425532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	2.52e-86	201	987	39	872	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.73e-64	193	872	2	686	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	4.89e-63	205	999	54	921	beta-galactosidase.
PRK10150	PRK10150	3.69e-53	201	609	10	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	4.92e-36	454	739	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24898.1	0.0	25	1117	29	1123
QUT50207.1	0.0	9	1118	18	1137
AQT68269.1	4.38e-307	7	1117	15	1213
BBE16084.1	6.04e-281	190	1117	40	985
AOM75904.1	8.79e-246	41	1118	43	1122

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BGA_A	8.93e-56	205	1047	50	937	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3DEC_A	2.59e-54	189	884	27	760	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	6.32e-53	204	867	39	731	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	6.34e-53	204	867	40	732	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
1YQ2_A	3.92e-48	203	855	33	734	ChainA, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	4.34e-58	181	987	33	904	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A4W7D2	2.79e-52	205	1011	55	930	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1
Q56307	3.47e-52	204	867	40	732	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
A0KQH4	8.53e-52	245	878	126	778	Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lacZ PE=3 SV=1
A3FEW8	2.02e-51	205	1011	55	930	Beta-galactosidase OS=Enterobacter agglomerans OX=549 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001294	0.997807	0.000288	0.000251	0.000181	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000658_00321.