CAZyme Information: MGYG000000658_00330

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000000658_00330
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
945	MGYG000000658_2|CGC1	101506.57	4.3546

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000658	1755704	MAG	Germany	Europe

• Gene Location: Start: 21335; End: 24172 Strand: +

Full Sequence      

MANSTFLLALALGLSALPPARAAGFRDLRAPSLLSGIPAAVPLRPAASLLAASPTDYPVN
FDADETTGNTGRYLTALTLSGSADGTQTIAVDHSAPMLLYRPMLGEVFTARPGERLTPVF
GFNGNWMNGYVYLDRGSDGQFSYELNDDYTIPEGSDLMTYSYVMAADGNGGYASDGTPLT
GNATNVLNPPPFTVPADLKPGYYRMRFKVDWGCVDPGGNTNPDQLIKNNGGEIVDVRLNV
HGDFCTVASAETPGGTVTAAGGSPLSGQDFPFGQPLELLVTPDAGYVLDGLVVRHGYGLD
GDSLVHGTPQYADEVLPGYLVQDGKATLPAAWMDGEVRIEARFVQASGEAPASGDYPLNF
DRDAQSGVPVPEDARFRLAVSATQGGTTGVSVPADGAALYVDLRPRQISVVPGDRVELAL
SQTVAPGLNAYFYMDLNQDGQFTPLLDAEGRPTLSGELVSYSFHDGRNSLGEAVAEGTDA
LPAFVLPDNLPRGVYRARLKLDADHTDAGGSGDIQARGGRVVDLLVNVHGLTQPLEIITT
NGSVHGADNTGLPLEAECFRSLSVVPVAAADGYESAGMTVQHGHNLDGPQYVHGNRQWST
FTRPARAVVIPRDSINGDVRITVHYEPTAEADYQLVFSDEFDGADGTQPSAEWWMRCPRQ
SSTWNRWLSDSEEVIYLDGGQLVARAIPNPDQAADPVPMITGGVQSQGKFSFKYGKIEAR
VLTNPHTGNFPAFWMMPEDQSAGWPSCGEIDIFEQIDNQNTAYHTVHSHWTYDLGNTGNP
RSSFSETVQMDRYHTYGFEWTEQEMKWYVDGRQVATYRKSADDAALQDGQWPFDKAFYII
LNQSVGNGSWAANADVSHTYETRFDWVRVYQKDGTSTGIGSPAAGEALRVSAEKGCIVVT
ADAPAEVGVYDLSGRCVARSTMSGTERFAVEGGIYVVNGQKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000000658_00330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	638	870	8.3e-53	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	6.43e-65	637	870	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.15e-30	639	870	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	1.20e-25	698	846	98	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	2.59e-23	633	871	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	1.56e-22	624	896	40	295	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13169.1	8.93e-102	355	872	24	542
QUB63276.1	1.98e-83	628	943	43	333
QUB75565.1	1.04e-82	626	941	41	331
QUB65408.1	3.92e-81	628	941	43	331
ASE16608.1	7.59e-81	628	941	43	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	4.49e-39	624	871	20	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	3.74e-29	632	872	2	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
3ATG_A	7.64e-28	635	885	5	253	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
6JH5_A	1.90e-27	633	872	4	233	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	1.19e-26	633	872	4	233	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	2.07e-42	629	878	52	295	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.01e-22	633	871	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	3.01e-21	611	872	400	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	4.35e-19	617	880	13	262	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	9.81e-15	629	846	16	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999117	0.000158	0.000161	0.000150	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000658_00330.