CAZyme Information: MGYG000000658_00571

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000000658_00571
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
947		105244.09	5.2811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000658	1755704	MAG	Germany	Europe

• Gene Location: Start: 133303; End: 136146 Strand: +

Full Sequence      

MKKKYLLCLLACAVLCPPGAGALDVPDTYVPGKKSMYHKGWIDFNKNGKKDVYEDPEADI
DARIEDLLSQMTLEEKTCQMVTLYGYQRVLKDSLPTEEWKTKLWKDGIGAIDEHLNGFRQ
WGLPPMRNELTWPASNHAWALNEVQRFFVEETRLGIPTDFTNEGIRGVENYIATNFPTQL
ALGHTWDRDLVRQVGYITGREARLLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAEL
GIEMAKGLQTDHQVASTAKHFIAYSNNKGAREGFARVDPQMSWREVENIHVYPFSRVIRE
AGILGVMCSYNDYDGFPIEGSYYWLTRRLRGGMGFRGYIVSDSDAVEYLYSKHKTARDMK
DAVRQSVEAGLNVRCTFRSPDSFVLPLRELVREGGISMETIDSRVRDILRVKFMIGLFDT
PYQTDLALADKEVNSAEHQAVALRASREALVLLKNQDGLLPLDKSAIRRIAVCGPNADEE
SFALTHYGPVAVEVTTVLEGIRQQAGKDIEVAYAKGCELVDPHWPESEIIDYPLDEDEKR
GIAEAVETVRQSDVAVLVLGGGVRTCGENKSRTSLELPGRQQQLLEAVMETGKPVVLVLI
NGRPLSVNWADKFVPAILEAWYPGSQGGTAIAEALFGDYNPGGKLTVTFPKTVGQIPFNF
PAKPASQVDGGQTPGPRGSQSRINGPLYPFGYGLSYTTFEYSDMQLSASTITDRQPVTVT
CKVKNTGSRAGDEVVQLYTRDVLSSVTTYEKNLRGFERVHLEPGETKEVRFELLPRDLQL
LNADKHWVVEPGTFLLMIGASSEDIRLKKELEVKAYGGQAVDGTAPQGPADFISASKDAR
HAGNVTDGNRSTVWTGSKGEFISFELAENAKVDHIRISWKKAAPDAAYDIQISNGGGQFL
SVKTGKVKPDTDEDIRFSRTGGSDLRILVTEGEAEIAEVSLPELRKK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	150	375	7.7e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.30e-176	56	806	30	758	beta-glucosidase BglX.
PLN03080	PLN03080	9.06e-98	60	799	49	769	Probable beta-xylosidase; Provisional
COG1472	BglX	3.68e-75	136	519	40	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	9.85e-71	450	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	5.39e-59	72	411	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDS02681.1	0.0	36	947	1	912
QUT50560.1	0.0	1	945	1	954
QQT77476.1	0.0	25	946	25	946
QRP57280.1	0.0	25	946	25	946
ASM65968.1	0.0	25	946	25	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	9.76e-134	59	806	9	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.29e-133	59	806	9	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	6.35e-130	136	806	103	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	1.01e-123	49	806	3	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	7.60e-123	49	806	3	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	6.01e-145	153	808	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	9.28e-126	56	813	31	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	7.76e-123	56	806	31	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	6.28e-115	53	806	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	3.29e-93	153	815	34	670	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000324	0.998871	0.000318	0.000176	0.000156	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000658_00571.