CAZyme Information: MGYG000000658_00873

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000000658_00873
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000000658_6|CGC1	42386.45	9.6863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000658	1755704	MAG	Germany	Europe

• Gene Location: Start: 18395; End: 19546 Strand: -

Full Sequence      

MKYFLIAGEASGDLHAAHLMQALRAEDPSAEFRFFGGDRMAAVGGRLLRHYRDLAYMGFI
PVLLHLRTILRGARQCEAAISLWRPDVVILVDYPGFNLRVARFVRRAALCPVYYYISPKI
WAWKERRIHAIRRDVDHLYSILPFEVDFFEGKHHYPITYVGNPTVDEVAAWQTARPEAGA
AGGDLPLIALLPGSRRQEVADNLSRMLRAAAPYAGQGYRLAVACAPALPLDFYRHIVERS
CPGALEAGWCQLVEDRTYALLAQAKAALVTSGTATLETALFRVPQVVCYYIGCGWFISIL
RRLLLKVPYISLVNLVCGEEVVPELVAGAMTVGNVRSHLASILPGGGRRAAMLEGYARMA
ARLGSPGAPRRAAADMVRRLRGR

Enzyme Prediction     

No EC number prediction in MGYG000000658_00873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	363	1.2e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.39e-96	1	373	2	368	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.41e-95	1	374	2	373	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.66e-67	4	328	2	324	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.13e-58	5	374	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.20e-39	1	334	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54418.1	2.77e-149	1	381	1	377
ADV43264.1	6.41e-149	1	383	1	379
QNL40994.1	2.26e-148	1	381	1	377
QUT32803.1	3.20e-148	1	381	1	377
QUT77942.1	3.20e-148	1	381	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.55e-31	5	325	11	327	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.72e-31	5	325	11	327	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.34e-66	2	380	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.80e-59	5	373	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.38e-55	2	373	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
A4XWS8	1.37e-53	1	346	5	344	Lipid-A-disaccharide synthase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=lpxB PE=3 SV=1
Q02AZ6	2.97e-53	2	382	3	375	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000658_00873.