CAZyme Information: MGYG000000659_00173

Basic Information

• Species: UBA10281 sp900556195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900556195
• CAZyme ID: MGYG000000659_00173
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526		59203.75	8.9341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000659	1920550	MAG	Germany	Europe

• Gene Location: Start: 188734; End: 190314 Strand: -

Full Sequence      

MKKKPVLYVVILCLWICCLGVLWFAYAKIVAGLHGYTVTAKTFIIVLLTINTVALSALWL
GSVKDLTFSVAYAVLRKKIEKRYAEIKEVTLDDENAPKFLLLYCTCNDFNAAALSACRKQ
DYPNFKTVILDDSSKSEYINEINRYAALREGVEVIRRENHVGYKAGNLNNYLADRTDYDY
FVVLDSDEIIPKDYIRKVLKYFAYDKNCGAVQARHEAQKGGNVFQRLMGLCVGSNGKTVQ
VIKNFYGANALIGHGMTVSRECYEKTGGFPLVVAEDISFAVDIKNAGLNVIYAPDILCYE
EFPVNYVSLKKRQCKWTQGNLEYMKKYNREIKESKMTWYEKLDLKLSHYSLPIVPILSFL
LAVCTICLGVLGYPVIRYSLIVYAVMILFLCSPMIPDFFVYNKSRNAFLLLPYFIINVAT
YASLAPMMLKTVLLGVFGKKATFIVTPKESENFSVFETIKYTFDSLVFAVVLGALSLIAC
GSLLPVIFVVAGCFASPFIVALSNISLPTKKDGCQTATVRKRKFEV

Enzyme Prediction     

No EC number prediction in MGYG000000659_00173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	114	305	1.7e-21	0.8478260869565217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	5.99e-32	97	322	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.54e-27	43	437	2	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	1.63e-22	113	319	19	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	6.74e-19	111	276	13	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06435	CESA_NdvC_like	4.21e-17	114	327	18	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL20008.1	9.90e-160	1	512	1	515
QDL19322.1	9.90e-160	1	512	1	515
QIN44161.1	9.90e-160	1	512	1	515
QIN44840.1	9.90e-160	1	512	1	515
QIN42784.1	9.90e-160	1	512	1	515

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8LIY0	4.11e-16	88	361	224	512	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
Q6L538	1.27e-15	97	361	230	509	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1
P74165	1.57e-10	121	362	134	381	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q0HUS0	8.77e-10	156	344	206	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-7) OX=60481 GN=opgH PE=3 SV=1
Q0HJ63	8.77e-10	156	344	206	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-4) OX=60480 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
42	63
351	373
378	400
407	429
468	490