CAZyme Information: MGYG000000659_01178

Basic Information

• Species: UBA10281 sp900556195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900556195
• CAZyme ID: MGYG000000659_01178
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	MGYG000000659_17|CGC1	63999.12	9.573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000659	1920550	MAG	Germany	Europe

• Gene Location: Start: 17245; End: 18915 Strand: +

Full Sequence      

MKTNVMKKSPALYIVMFIIWTALAAFLWYNFICVIIDVPFIIPSDKINRGIKITASILLT
LNALFISYFWLNGVKDFIYVVWYYIAKSALIKRHEEIIDETVSNCSAKVILAYCTCNDFD
GNSLLKSMRQDYGNFETVILDDSGDEKYKRAIDEFAIKNGVTVIRRKDRKGFKAGNINNY
LLSENVKNNYDYVVILDSDEILPPNFIKESLKYFLNYKNVGIVQANHISTRNRNLFMKLF
HIGVNSHWPTYQTMKHFYGFSTMLGHGAMISRECYLAAGGFPNLVAEDLCLSIEARNHGY
YVAFAPNIVCEEEYPVDYVAFKKRHSKWTQGNLEFIKRYTGKIIKSKMKWYEKADIVLFT
YNLPLTAIFAFFIFLNLVFAPLLNINLGAVYKLWMIIPTVIFFFSPMLNDFIVWTTKFNP
LRNLAYFFGVIVLYGSMLTTSLISALLGMCGKKAKFIVTPKTATKITFWQAVKFQKNEIL
FSSLLLTIGLIMHNVLSVILIISTGYLSLFLLFLSNRTYNETQIQKIDAQSSKISLSTNK
TYVYTENLEEQLKKSA

Enzyme Prediction     

No EC number prediction in MGYG000000659_01178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	127	329	2.5e-24	0.8869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	6.16e-33	122	334	19	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.64e-25	124	434	73	396	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	3.65e-24	139	331	37	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
pfam13641	Glyco_tranf_2_3	1.10e-20	129	331	26	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06423	CESA_like	3.43e-20	128	288	20	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEU60418.1	3.18e-190	2	537	17	559
CAB51329.1	1.96e-171	7	516	5	504
QWW19438.1	2.98e-166	4	516	2	502
CAO99137.1	5.02e-143	6	491	1	467
CUW19324.1	5.02e-143	6	491	1	467

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNI7	1.12e-10	139	361	133	362	Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CSLA2 PE=1 SV=1
Q67X45	1.74e-08	139	347	151	366	Probable glucomannan 4-beta-mannosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA3 PE=2 SV=1
Q9U720	3.10e-08	173	350	600	779	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
50	72
356	378
393	415
424	446
491	513