CAZyme Information: MGYG000000659_01585

Basic Information

• Species: UBA10281 sp900556195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900556195
• CAZyme ID: MGYG000000659_01585
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829		93746.67	5.22

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000659	1920550	MAG	Germany	Europe

• Gene Location: Start: 2984; End: 5473 Strand: +

Full Sequence      

MLKIINFKTEYQVSPLGVDNKKPRFSWQYSEAADITGYKISVRKDGKSAVNVWDSGWLGY
VDSIGIEYGGKALESHTRYFVNAAVKTASGEIIESGEQAFETGLFDESDWKGKWVAIPVN
FNGGTLLFRKVITLPKDKKVLRARAYICGLGYHEFFLNGKKIGDERLNPSVTEYAERVEY
CVYPMDDLLVGDNVVGVEVGYGWFGARKLNAQFYVEFDDGSYFEDHSGPANGWWVGGSPT
IDNGIYSGEIYDARIEEKYPLNWATLDYEPTWANGWMYTIATDAPRGKLVSQYINPIKVC
GTFKEVSRENKGNGVFVSDMGANFAGWVRIKVKGERGAAVTMKFGERLDDNGFVNQLNLR
SARCSDKYILRGDGIEEFAPRFTYHGFQYVEFVIEGNAELLEVVGEHVHSSCEVVGSFKC
SDETLNKLHEIAVLTERSNEHSILTDCPQRDERFGWLNDLGSRVFQTVYNIDMSRFFPKF
ARDITHSQTAKGEIADTVPFYTGGIPADPVCVIYLLMADYAYRYYGDKSVCESEYEHLKA
WVEYLKSRSKGYITDYYYYGDWVLPYPETVQPDNIFVSTAYLFWHLKEMKKIAGIVGNKA
DIELYSKDIELCRKAINDKYFDAETKNYSRGTQTENALAVSLGICAEKHTAEVAENVYKD
VVARNYHCTSGNVGYRHVFYVLAEYGHADAVVKILKNPEYPGWGYMIASGATSVWERWES
KMTNEMHSFNHPMYGSYDAFLYKFLGGIDVAEDAFGADKLTVAPVFADGIDFVETTYKTV
RGMLEVKWQRSESGVELDITVPPTSTVDLLCGGEKRELKAGRHTLKIDK

Enzyme Prediction     

No EC number prediction in MGYG000000659_01585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	311	808	3.4e-142	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.05e-94	415	743	3	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.24e-38	138	299	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.51e-34	314	409	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.50e-10	750	826	2	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	7.47e-192	2	805	32	845
QEC51112.1	1.57e-187	2	806	69	890
VEH16339.1	1.79e-176	1	829	31	872
AEE96386.1	1.43e-169	5	810	11	841
AIY87265.1	6.23e-164	1	802	1	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.94e-152	6	805	34	892	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.72e-97	2	809	4	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.25e-85	2	827	2	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3CIH_A	1.27e-06	306	786	184	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.21e-96	2	809	4	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.85e-91	14	828	46	889	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	9.80e-89	14	810	42	905	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	3.30e-83	13	802	41	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000659_01585.