CAZyme Information: MGYG000000661_00052

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-302
• CAZyme ID: MGYG000000661_00052
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000000661_1|CGC1	43390.4	5.8995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000661	1287314	MAG	Kazakhstan	Asia

• Gene Location: Start: 49761; End: 50852 Strand: +

Full Sequence      

MINKYKICVYAIAKNEEKFVERWVNSMKEADEIYVLDTGSSDNTVKKLQKKGVHVAVKEI
KPWRFDVARNMSLALVPKDCDICVCTDLDEVFEEGWRAKLEEKWCEGTNRARYNYNWSLD
DNNKPIVNFYIEKIHSRNDYKWTHPVHEILTYMGNEIERFIIVENMTLNHYPDSSKSRGS
YLPLLELSVKEDPEDDRNMHYLGREYMYYNKWNECIDTLIKHLKLKSATWKDERAASMRF
IARSYKNLGRFDEARMWLDKAIEEAPYLRDPYVERALLEYQLENFEVVEKYCLEALKIDR
HEKTYINEPFSWDHTVYDLLSISCFYSNKLKEALYYSNKALEMSPQDERLLENNKIIKNK
LGE

Enzyme Prediction     

No EC number prediction in MGYG000000661_00052.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.80e-11	6	172	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	1.09e-08	235	342	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam00535	Glycos_transf_2	1.01e-07	8	147	1	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
sd00006	TPR	2.30e-07	199	297	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0463	WcaA	1.24e-06	3	301	1	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX65321.1	5.67e-143	2	363	1	362
ACV63878.1	5.67e-143	2	359	1	357
QAT50106.1	7.81e-139	2	363	1	362
AQS58818.1	4.86e-137	2	360	1	359
AQS58819.1	2.27e-133	2	361	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000661_00052.