CAZyme Information: MGYG000000661_00212

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-302
• CAZyme ID: MGYG000000661_00212
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		28078.81	4.4604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000661	1287314	MAG	Kazakhstan	Asia

• Gene Location: Start: 39499; End: 40242 Strand: +

Full Sequence      

MNVKLFFIYPSMNIGDANENVIILQSKLKDLGYFFSSITGIFDSYTEDVVKKFQNNNGLI
SNGTTNFETWKTLFSPTTDVNNLMTIDTKPVLRLGSTGPYVTELQEVLTKLLYYTSSIDG
NFGTETENAVKRFQINNKLTADGVVGRDTWSALYSLYSPLAICDEEPDQEYFLYTVVAGD
TLWSIARRFGTTVEEIKRLNSLTSDLLRVGEILKIPNVTNEETYFLYTVVAGDTFFMRNN
EKKYCFI

Enzyme Prediction     

No EC number prediction in MGYG000000661_00212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	174	216	8.5e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3409	PGRP	1.86e-25	13	153	40	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam01471	PG_binding_1	1.89e-18	97	153	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
pfam01476	LysM	2.15e-16	174	216	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	9.21e-15	174	215	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG3409	PGRP	3.87e-14	57	155	12	104	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH19058.1	2.92e-23	90	216	69	195
CCC57680.1	9.90e-22	15	218	31	223
ABW20078.1	1.70e-21	90	217	69	198
AUS95891.1	1.70e-20	95	230	7	135
ADI02383.1	3.13e-20	14	217	48	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	1.17e-12	174	217	5	48	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	1.59e-11	174	217	5	48	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
3BKH_A	2.74e-11	91	159	11	79	ChainA, lytic transglycosylase [Pseudomonas phage phiKZ],3BKV_A Chain A, lytic transglycosylase [Pseudomonas phage phiKZ]
5TV7_A	1.12e-10	81	159	98	175	ChainA, Putative peptidoglycan-binding/hydrolysing protein [Clostridioides difficile 630],5TV7_B Chain B, Putative peptidoglycan-binding/hydrolysing protein [Clostridioides difficile 630]
4LPQ_A	1.19e-07	95	159	14	78	Crystalstructure of the L,D-transpeptidase (residues 123-326) from Xylanimonas cellulosilytica DSM 15894 [Xylanimonas cellulosilytica DSM 15894]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	2.52e-09	174	220	88	134	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
Q01838	4.94e-08	174	215	320	361	Probable endopeptidase p60 OS=Listeria seeligeri OX=1640 GN=iap PE=3 SV=1
O07532	6.44e-08	173	220	93	140	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
L7N653	1.06e-07	11	166	11	179	N-acetylmuramoyl-L-alanine amidase CwlM OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cwlM PE=1 SV=1
Q01837	2.90e-07	174	215	314	355	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.965262	0.034444	0.000124	0.000071	0.000039	0.000075

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000661_00212.