CAZyme Information: MGYG000000666_00059

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_00059
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		70736.8	9.684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 25410; End: 27287 Strand: -

Full Sequence      

MRFSSILSLLSAFFLTGLPVSSIAAETSATIGSPYGICAHLNRWEYDRMPQELELIRQAG
IRHVRTDLDWNQIEPEKGKWNFERWDALVKEAEKRDITLLPILGGSQPRWGSPLVKHMDD
WKTYLETVLSRYPALPCWEVVNEPNLNEFSRAEAYVPLLKESYRTIKRIHPGANVTTGGM
GDIPLPYLERMLKSGASGSFDIMNVHPYYWKGLPESSLAWELQELRKQMRKYGSEKPVWI
TETGYATASGRNMTGITHAALRKLNLHRDSTPVVLICDDDFHYYSEGRNIHRLAFFSPNR
KFREITLKELGKLDPGTSPLLMLSVTEGFPMAFAKELLGYVKNGGTVFIPGGGIPMYYNY
RRQNGAVLRDSAADSILKQFHIAWDAWWVNPKAPKGTSLQETAPGFGKLSYPGSAGRFLS
DRNLKPGDRLIPIVTASSKDRTYSAPVAGIYQFNSDLKGNFLIYTWTEYADSVSKETQAE
LLPRTFLIALSCGVEKVFWYNFRSMGSSPNSREHHFGIVERDLTPKPAYHAYKTLTEMCP
AESTRPQLTKRGTLYRASWTRPDGGKSYALWRIRGTGPEQLRIRGNLKEIRNHLGKVQSW
KGGPLPISDAVTYLSGDRTLSVDFR

Enzyme Prediction     

No EC number prediction in MGYG000000666_00059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	76	228	1.7e-17	0.4431554524361949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	9.68e-08	70	166	3	111	Glycosyl hydrolase family 10.
COG3693	XynA	5.88e-07	66	173	65	187	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.26e-04	42	110	5	75	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam11790	Glyco_hydro_cc	0.001	142	242	71	168	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
pfam00331	Glyco_hydro_10	0.002	70	144	46	128	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	7.69e-161	22	623	17	617
QDU57372.1	1.50e-97	1	623	1	631
AVM44901.1	8.25e-67	33	589	25	599
ADE82856.1	1.33e-42	31	622	34	406
AHF90941.1	2.76e-39	16	551	214	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	1.46e-14	36	250	22	258	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.46e-14	36	250	22	258	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
5JVK_A	7.37e-13	36	260	107	358	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000268	0.999097	0.000156	0.000173	0.000143	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_00059.