CAZyme Information: MGYG000000666_00149

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_00149
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
977		110850.55	9.6185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 20051; End: 22984 Strand: +

Full Sequence      

MNFRILSAVFCSLLISGTLFAAVAVDFSKDSLIHYPLPNHPEDRIRIGKSEIPGKGKTGV
SLSWETEHYHYTQTGILRNPLPEFQKFRKMELMLNVFVEPGSRVSQFGLRFRDAEGEIFQ
ISSERLTSGSNGNQRIALLFDAEKLPPSWGTKQNRKIDWPLRLFGMTVSFPPQSGRGRVV
FESIETLNPDRLLDSVEVRTDTGHPLHLLLSEHGNPRLSFRNTLNRPVSFLAEWKLSDFR
GKTLAASRKRMNLPPENTIAVPIPGKFPLGIFYVDYRLKMTDGSGETSGRRSFAFLLSSG
EKKARQGEFLFGVCSHPGRIPPEEQELEALAASLCGARYLRTGISWESLERQKGKRDYSR
FDRVVDTFLKYGIETQVLLAFTPRWAVSGEGSPVYPKDRRLMFRLPDYDAYASFAEETAR
RYKGKLRFFEIWNEPDISFGNFTTEQYLKLLRAGYEGVKRGNPEAVVMTGGFTYMPLSDV
PPKPGMMRRTLIEGKGFYDIHAFHGHGPFEHYRPQIPAMLEMRRNGRISAPWYANETADH
SIRGEVHQAVTLFQKLIFSWANGAMGYNWYDLRNDGYDRYEKEHNFGMLTRDFQPKAVYP
VYGMLTRLFAPASFRKTRNPGGGIYLYEFETPGAVLLPMWRDEGSLPSVLAWKTDARKAE
AVDLMGNRTALAMEAGFVLATPEQIPCTLILHGAKKVEFAGFAVQFTQPGLQIPGTPAYL
PFVLQNPFPQERSFRIGSGSHSAVYPLKGGAEQRIRIQTDSPEFCWQLGDSFRGTLPVSF
LRARVISAEAHRKPDFVLNRDENRVELFPNNPLMRHMTWKGPEDLSAEIRLSLRKDSLIL
EAEVVDDRHVQPYARSMVWQGDNIQAAFRFPNQTGNWEIGLSRLDSGKAEVFFWDAPRKA
DPSAVRLSTDRKGNRTCYHAEIPFSLFGIRRGDLACGFRFNLLVNDNDGDGRKGWLQIAP
GLGKDKSPVHYPVLIFP

Enzyme Prediction     

No EC number prediction in MGYG000000666_00149.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	355	608	5.9e-29	0.6566125290023201

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.35e-60	794	976	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.15e-10	818	954	29	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam01229	Glyco_hydro_39	3.19e-08	336	476	47	204	Glycosyl hydrolases family 39.
cd00241	DOMON_like	4.71e-08	817	955	10	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	4.99e-167	57	976	80	1032
AVM47149.1	1.73e-164	186	976	481	1306
AVM44759.1	4.20e-163	176	976	124	964
AVM46276.1	7.33e-159	174	976	306	1136
AHF90198.1	8.28e-154	56	976	53	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	9.96e-18	312	718	107	521	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003950	0.994707	0.000415	0.000318	0.000281	0.000290

TMHMM  Annotations     

start	end
5	27