CAZyme Information: MGYG000000666_00240

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_00240
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984		111678.43	9.9136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 29428; End: 32382 Strand: +

Full Sequence      

MRKLLFLLLLGGAAAADAVTLCDFIGERLPVPVWQGRKLEQSATYEPGGLRVRWNTARNG
TCIFGEPWKKTEPLGEFRKADCHVELELPEHVALTSFRVRFIDSQKEVFQWGTVADFRKP
GIVRLTIPMTQTNFQGAFRGNNDKKIDFPIRFYSCVATALKNSGEASILVRKIEYEPTLP
ESNLNRVELNLETGTVPRVLRKGEESALTLLLRNPGSTALSCRAEIEFRDFYDNVLRETA
DLTLPANGTGKYAPKTRLPRLGHWTVTLRLKSSDGASSAERKRSFAYLIPAGPGTLRKEG
FLFGICIPAWYDPKIFPLEAETAALCGASALRLNFRWRELERTRDTWHLGLLNRILNEYE
KRGMEVMPILSNPPVWARKNTPNSMPDLNEWRKYVAFFFRNYGERIRFWEIWNEPDLLSF
CEFGAPEYVKLQKIAREEQRKWAPQARLLTGGFAHAYPDNNKNGLQEYVLANAKAWFDIH
AFHGHGGFKAYRRQIEEFLLPMRKRNHVKAPWFANETAVSSCGIGERKQAETLFKKLLFS
WSAGAIGYNWYNLRNNGFRANDPEHHYGLVTFDFYPKPVYVVYNTLATVFRNKEFVRRHN
RGNVIWILEFAGGGDRAVALWNDSPETTPDEIATFRSNAESVEIMDLMGNAQPLSSENGT
VEVQIRRDPVILIFRRCSSLHDSGSSAKGWITGGAVPGIPAHWNLSLRNPTDKERTVRLN
LKPGKGVRVGSVPAEVSLKPGERKRISAEVNVEEGTSSSSQALDLRLASGTREFRIRFPM
RWTIFIPQKKKSKQWDFLLRDREQVHALFDADPGNLHRLWSGPEDLSAGIRMNVRKGIWT
IQISVTDDKHVQPERGVNVWKGDNVQIAFRIPGQSSLWTAGLTLLSDGSPELFLWDTPKT
FSAGDVLRTWKLKAARKGNRTEYKVTIPLASIGVDSRLLKQGIRFNALINDNDGYGREGW
IQITDGIAGTRSSESYPLLIFESE

Enzyme Prediction     

No EC number prediction in MGYG000000666_00240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	353	628	4.9e-19	0.7169373549883991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.44e-49	795	981	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.25e-07	819	959	29	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	6.02e-04	841	961	33	156	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd21510	agarase_cat	0.003	393	463	85	159	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46276.1	1.97e-177	163	982	306	1137
AVM47149.1	1.66e-169	49	982	213	1307
AHF94342.1	1.20e-156	46	982	79	1033
AVM44759.1	3.04e-156	231	982	202	965
AHF90198.1	2.14e-139	35	981	39	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	2.39e-11	304	675	107	499	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	3.63e-07	310	581	29	323	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	3.63e-07	310	581	29	323	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.999055	0.000150	0.000159	0.000141	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_00240.