CAZyme Information: MGYG000000666_00333

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_00333
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		28440.5	6.6784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 32290; End: 33039 Strand: -

Full Sequence      

MNILWVTSEAVPYAKTGGLADVSSALPLALSERGHRVSVVMPFYPQIMGRLNLKFSATHD
LLRVPFGSGCEWAKVNELKINDNLTYYFIEYHRFFDRASLYDWCGSEYADNAMRFIFLSR
AAMELASNFRLAPDVLHANDWHAALCCVYLKSHLYRDNEQFRNCRSVMTIHNIGYQGVFH
KGNLFWTGLGWDYFNYLCLEWYDQLNLLKGGIMTADMVSTVSPTYAQEILSPEYGFGLDG
ALRSRCAVS

Enzyme Prediction     

No EC number prediction in MGYG000000666_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	245	3.1e-80	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.42e-105	3	243	1	238	Starch synthase catalytic domain.
PRK00654	glgA	4.77e-101	1	245	1	228	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.29e-99	2	245	1	239	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	1.59e-75	1	249	1	244	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	2.34e-45	1	245	4	240	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM04087.1	9.80e-110	1	247	1	248
QDU62030.1	2.17e-68	1	247	1	246
QDV52381.1	2.53e-63	1	242	1	245
QDT44223.1	6.89e-63	1	242	1	245
QEG18479.1	2.69e-62	1	244	1	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	8.98e-38	1	248	1	240	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3D1J_A	3.01e-37	1	245	1	235	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	6.44e-37	1	245	1	235	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	6.44e-37	1	245	1	235	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZV_A	8.86e-36	2	248	2	240	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74ED9	7.04e-59	1	247	4	250	Glycogen synthase 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=glgA1 PE=3 SV=1
B5YG91	4.96e-58	1	245	1	256	Glycogen synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) OX=289376 GN=glgA PE=3 SV=1
Q7UPY2	7.88e-54	1	243	1	251	Glycogen synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) OX=243090 GN=glgA PE=3 SV=1
Q1DCS0	1.21e-53	1	245	1	243	Glycogen synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=glgA PE=3 SV=1
A7H6L1	2.28e-53	1	245	1	237	Glycogen synthase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_00333.