CAZyme Information: MGYG000000666_00726

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_00726
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000000666_25|CGC1	72504.07	5.349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 17694; End: 19610 Strand: -

Full Sequence      

MDLFKSGHFFTGCNYWASHAGMFMWRKWDGEVVRQDLAALSSHGMSVLRVFPLWPDFQPL
KRLYGGGGRRMGLSCGEVLLSAEEERMGGVDPVMLERFRFLCDRASENGLSLIVGLLTGW
MSGRLFVPPAFEERNILGDPEAVKWEVRFVRRFVREFRDHPAIGAWDLGNECNCMSRVSG
ESEAWEWMNTISSAIRLEDPSRPVVSGMHSISTDAWADWNMYDQGELLDVLTTHPYPLFT
PECNREPFYTLRNELHSSCESLLYEGISGKPCFPEEAGSLGPMICSDDRAAASLRCALFS
CWANHLHGFLWWCAFDQTRLSFAPYDWTAVERELGLFHEDRLAKETALVLKEFSAFLKEF
PYSLPERKVDAVCLMPRRTRNCFPEALGSYLLAKQAGFELRFSGVEEKLPESEFYLLPSV
GDLSWLSRHSWLSLLEKVREGATLMVSLDGCGMLSPFREVFGVRVDARWKEAHALQIHFK
DSPERKIRFNVEYYSHLIPEGAEVLAEDSDGFPMMTVASYGKGRMILLNLPLEYLAATSS
GCFYGKELNPAYLLYRKGAEIAGVRHAVFCKEPGVGVTEHWLDEKRMLAVLINYDPQPVE
CVPHLTGKLSKVWRGTFEGDRLRIEANDSAILLLTMEE

Enzyme Prediction     

No EC number prediction in MGYG000000666_00726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	316	3.2e-33	0.8095238095238095

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3934	COG3934	2.36e-18	9	580	4	559	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.98e-04	139	237	103	196	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PVY35568.1	4.20e-185	7	599	6	595
AVM43652.1	1.55e-184	1	599	8	603
SDT99127.1	1.02e-176	6	634	8	630
AEI40351.1	1.17e-173	6	617	9	621
AFH61205.1	3.32e-173	6	617	9	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LR7_A	1.72e-18	12	352	17	341	ChainA, Uncharacterized protein ScGH5_18 [Streptomyces cattleya NRRL 8057 = DSM 46488]
7LR8_A	9.68e-18	12	352	17	341	ChainA, Uncharacterized protein ScGH5_18 [Streptomyces cattleya NRRL 8057 = DSM 46488],7LR8_B Chain B, Uncharacterized protein ScGH5_18 [Streptomyces cattleya NRRL 8057 = DSM 46488]
6MP2_A	1.74e-13	5	340	17	338	Crystalstructure of BlMan5B solved by SIRAS [Bifidobacterium longum DJO10A],6MP2_B Crystal structure of BlMan5B solved by SIRAS [Bifidobacterium longum DJO10A],6MPA_A Chain A, BlMan5B [Bifidobacterium longum DJO10A],6MPA_B Chain B, BlMan5B [Bifidobacterium longum DJO10A]
6MOY_A	9.48e-13	5	340	17	338	Crystalstructure of the E257A mutant of BlMan5B in complex with GlcNAc (co-crystallization) [Bifidobacterium longum DJO10A],6MOY_B Crystal structure of the E257A mutant of BlMan5B in complex with GlcNAc (co-crystallization) [Bifidobacterium longum DJO10A],6MP7_A Crystal structure of the E257A mutant of BlMan5B in complex with GlcNAc (soaking) [Bifidobacterium longum DJO10A],6MP7_B Crystal structure of the E257A mutant of BlMan5B in complex with GlcNAc (soaking) [Bifidobacterium longum DJO10A],6MPC_A Crystal structure of E257A mutant of BlMan5B [Bifidobacterium longum DJO10A],6MPC_B Crystal structure of E257A mutant of BlMan5B [Bifidobacterium longum DJO10A]
7LR1_A	2.09e-11	5	355	17	349	ChainA, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR1_B Chain B, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR1_C Chain C, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR1_D Chain D, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR2_A Chain A, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR2_B Chain B, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR2_C Chain C, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813],7LR2_D Chain D, Glycosyl hydrolase BlGH5_18 [Bifidobacterium longum subsp. longum ATCC 55813]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0C8J3	5.82e-06	33	237	62	288	Probable mannan endo-1,4-beta-mannosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=manC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_00726.