CAZyme Information: MGYG000000666_01030

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_01030
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		98904.8	6.282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 11430; End: 14042 Strand: +

Full Sequence      

MNAIRPRLPQLLSAALVLCLCSCSAGPEQRAEVPGKPEPNLAETAEQEKQMQIINLAGEW
TLSCSSNDFRPIRADVPGDNYSALLRNGRIPDPYLGRNEEEVQWVRELDWTFSKEFSISP
ELLSKESVYLNIDSLDTFADILVNGKKAATSRNMFRRLRIDVKELLKPGRNRLDIVLFSP
VAKAAEEALKQPFDLGINGNNRVPYMNLIRKVQCHAGWDWGICLVVSGIYGDISLRGVDH
ARLDYVFTEQKHAPGKCTLEATAELFSENGGETTVCFEFNGEKKNRTVRLLRGVNTVSAS
FEVENPALWYPAGYGPQTLYPLTVSTADETIRKRIGLRKLELINEPDAYGISMKFRVNGI
DLFCKGANWIPADAMPSRQTREVYDRLLSDAVAANMNMLRVWGGGQYENEDFYDLCDQKG
ILLWHDCMFACAQYPSTPDFLENITGEIVHQVKRLRDHACIALWCGDNEVISLMGGNGSP
GYPMRLINYDRFNRTVRRAVEDADPTRVFWPSSPCSGPEYVAGGTHNDSMGDMHYWSVWH
SGKSFSAYFDVIPRFCSEFGYQSFPAQNTVDRYTEGRQRNVTSPVMEHHQRNSGGNSKIV
EMFTRYFRFPDGFENFIYLSQVQQAFAIKTGVEFWRHLKPVCMGTLYWQLNDNWPVASWS
SIDYDGNWKQLHYHAKRFYSPVIVTSFLNSDQRLELWATSDVNSEFKGAVHASLLDFSGA
KQKEFDFEFQLPPLGSKKIHEFEAEALTGEDPAKVFLFLTLDGNAGGKRYTHYNDQFFTE
FKRCDLQQPRIRTGLQKRSGGTWSLTLETDRPAFYTFAELRGMQTVFSDNSFTLLPGAPR
TITFQVPETVDADALKRSLVIRDLRSSYRE

Enzyme Prediction     

No EC number prediction in MGYG000000666_01030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	43	715	2.6e-98	0.6688829787234043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.24e-116	51	682	10	632	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	2.49e-18	788	865	1	77	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	9.16e-12	692	782	1	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	2.44e-06	227	490	195	475	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	9.86e-06	241	338	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44113.1	7.32e-307	53	868	4	821
QQE12237.1	3.92e-293	48	868	5	829
QDU34180.1	1.76e-285	48	868	5	835
ADK80325.1	4.90e-240	60	843	10	798
AYV24530.1	3.92e-239	51	868	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.62e-161	52	870	7	840	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.71e-161	52	870	9	842	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	9.73e-161	52	869	9	841	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.56e-160	52	869	7	839	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.94e-159	52	870	7	840	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	1.02e-123	54	868	23	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	8.35e-121	54	868	23	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
O00462	1.22e-119	55	868	24	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
A1D911	1.26e-115	50	852	3	836	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	1.76e-115	50	852	3	836	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000375	0.047158	0.952211	0.000116	0.000099	0.000066

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_01030.