CAZyme Information: MGYG000000666_01340

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_01340
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	MGYG000000666_59|CGC1	67059.08	9.9077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 13891; End: 15657 Strand: -

Full Sequence      

MKTTLITCIAALTALSLSGGSLMPEKGRISIHGADGASFRKQGEKLILKREKPGIQHFLR
GMLRFRQELDGKFAENDALVIELKTDKDLSLRTRWRKNDKRMCHTPDVPIPAGKEFQQIV
LPLPDSRGKQLTTLELQFTPDPGSVEIRKIAIEKPKKVTLHLEGNPCKVQNEAIFRGTTA
VPETDVVISIRNSRGEVRSKTVKSRNGVFELRWKRPPINIGVWNTAYARIGSGKSAAETS
IPLRIFGYRADDSFAWLKVKGKDIMTSPLAKDGEHPFVPVGIGYARDVIIPAQDDEAMKF
CKDRNLNTIRLPFYTRFFNNRDTEPLDIDEHIRDFILPAVLAAKRHNLYVILDDHGYFTS
KIDEAKARQAQKVPRWSDEGFAEWIRRWVKVAEFFKNEPNVLGYELLNEPHDIAPEAARK
WYTRCLKAIRKVDQRHIILVGTADWSHSRALEKTWGATASTVDAPYNNVVFSFHDYPEDN
HPWHVAKSITAFRDKHNVPVLCTEFGATHWNKSETVCREFIAGMLILFARERVGWMIWAL
KQLQDNPRSPYNQVDKTGINPPRYDSCPYSDLWVPAAKIMATPFPKAR

Enzyme Prediction     

No EC number prediction in MGYG000000666_01340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	295	549	1e-43	0.7454545454545455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.92e-30	291	540	22	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.94e-09	302	542	83	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT89144.1	1.52e-165	252	585	29	363
AIA99600.1	3.71e-22	295	546	102	345
AIA99611.1	9.12e-22	295	546	103	346
QIK53840.1	3.91e-21	296	543	102	341
BBE18442.1	5.54e-21	296	548	107	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AMC_A	4.79e-13	295	538	36	286	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	2.78e-12	295	538	36	286	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
3AZR_A	2.78e-12	295	544	36	277	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3RJY_A	3.82e-12	294	507	43	263	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3RJX_A	3.82e-12	294	507	43	263	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	1.66e-13	295	543	73	340	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P23044	1.79e-09	349	575	114	358	Endoglucanase 1 OS=Robillarda sp. (strain Y-20) OX=72589 GN=eg 1 PE=1 SV=2
P23548	1.03e-08	295	506	80	319	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
P15704	6.04e-07	296	540	82	299	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
Q6L6S1	2.06e-06	357	476	182	307	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000131	0.103478	0.896302	0.000033	0.000041	0.000035

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_01340.