CAZyme Information: MGYG000000666_01436

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_01436
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		68334.88	5.9622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 9468; End: 11273 Strand: -

Full Sequence      

MEIRTDRTTFRLDKNDPGSVWDLRTSWKETEKDLFFLEFSLDAAEDLPPPELTLSWDLPL
LDTVNCWTTCHGGGSELQPDWGRKHHFSIADEIPELVFHNREGICTVAAAYSDAMRVTEF
SGGIHESDCSLRFTLKVFTRKEMPLRHYRGILRLDLRRMFFADTVRAISAWFATLPGYGN
TPVPESAFDPLYSTWYSYHHDVHDRTVLQECREAAKYGMKTLIVDSGWDNDDNTLGPIAC
GDWEPSKKRFPDFASHVREIQNLGFRYLLWFAVPFIGKHSSRYAHFQGKYLFELPDAGVL
DPRFPDVRKFLIDSCSRLMREYGIDGLKLDFINTFTECTDDPALTSGMGERDIPVITDAV
DRLMTDLSSAIRAVRPDALIEFRQCYIGPAIRKYGNLLRAADCPADPGGNRRRTLNLRLT
SGCTAVHSDMLEWRSDYDVRHAALQLLNIMFSVPQISVRLAELPSDHRQMLEFLLGFFVR
HRALLVKSDLHPCAPDQNYPLVYAEAEGERIAVLYCGGITAELGFSPTIRSLYLVNATER
EYVFADLSLFPGTAALLRDCRGEILPFEPPQTGLSRLRMPPGSILRLRAPEFSDPRKGAL
P

Enzyme Prediction     

No EC number prediction in MGYG000000666_01436.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.07e-55	190	478	4	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.09e-14	190	331	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.97e-14	191	381	44	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06597	GH31_transferase_CtsY	5.10e-08	181	330	4	164	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	4.57e-07	191	331	295	442	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	1.97e-160	21	588	19	586
QTH41069.1	2.80e-133	18	589	18	590
AYV23198.1	5.78e-129	25	587	22	591
QMV40951.1	1.40e-128	36	587	34	585
ASI90717.1	2.29e-128	25	587	22	591

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CVH2	1.63e-07	191	330	350	507	Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglC PE=3 SV=1
Q5ARP5	3.33e-06	191	330	329	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_01436.