CAZyme Information: MGYG000000666_01623

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_01623
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		58928.32	5.834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 6497; End: 8074 Strand: +

Full Sequence      

MSIYQHSIRDERIREYVPVSRILLQEKISGAGEWIGSGSIQPMFSDSITGARLESGGSVL
LDFGIELHGGIRIVNLGKEGRVRIRFGESVSEACGTPNQCHAIHDTEVAVPEFGMLEYGN
TAFRFVRIDNAGGELFLLNVIAVALYRDLEYAGSFESSDERLNRIWKTAAYTLQLNMQDY
IYDGAKRDRLVWMGDLHPEIRGILAAFRDVSLIRKSLDFLTSTTPLPLPMNTIRTYSCWW
VIALADYYQATGDLEYIRAQKEYLLGLLELYGTYLSADGSECIPERRFLDWPSDEDLPAK
HAGLQGLLYWMFRSGETLLRALDCDVTTVLSVQKRLKGRIPDCGENKAAAAIQTVGGLAD
RSDVLLRNPLHGISTFYGFYMLLAQPTRPALELIRRYWGAMMDRGATTFWEDFNLDWLEN
SGRIDEFTPKGKRDLHADFGAYCYKGLRHSLCHGWSCGPMPFLSERVLGIRFLEPGGRKI
LVKPDPAGLEYVSGTYPTPFGSVSVTCEGHGRIRIEAPSAIEVLQ

Enzyme Prediction     

No EC number prediction in MGYG000000666_01623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	55	323	6.6e-51	0.5595238095238095

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.23e-09	152	260	3	123	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.001	469	505	1	38	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45729.1	1.62e-161	4	506	11	527
BBE16159.1	1.50e-155	13	524	39	583
QEM11316.1	6.24e-152	11	525	38	586
QTE39593.1	3.54e-151	11	525	38	586
QTF59433.1	7.08e-151	11	525	38	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.89e-38	57	505	192	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.01e-16	52	465	88	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998763	0.001229	0.000034	0.000003	0.000002	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_01623.