CAZyme Information: MGYG000000666_01668

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_01668
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		66892.42	6.253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 3071; End: 4837 Strand: -

Full Sequence      

MKINTIVGEVEVRGGFGNEWRVSLDRTTAETGVEEIRIRLEADAPAVLPETTLLWSVPQL
DMQTRWTPSCGFNRNIPPDWGGPLSSNLASSAPVMAFLNLKGQNRMTFACSEAMREVKLY
GGVCEESNRISCRAVLYSAPEAPVSSCEAVLRFDLRNIFYADAIRDVSVWFASFRDYVPS
EAPAAAFEPIYSSWYSYHQNVFDHELERECALARTYGMKGIIVDDGWQTDDNQRGYAFCG
DWEISKRRFPDMRAHVARVHAMGMKYIVWYSVPFVGEKSRAYERFAGKYLYSIDRLHTSV
LDPRFPEVREYLIGIYETAVKEWDLDGFKLDFIDSFRVNGEDPALKDQYAGRDVKSVPLA
VDLLLSETMRRLRALKPEILIEFRQSYIGPAVRKYGNMFRAGDCPADVLANRVRTIDLRL
TSGKTAVHSDMLEWNSGDTPEHAALQLLHVLFSVPQISVRLNDIPEDHRRMLHFWLDFFV
QHREVLLRGYLKPFHPELNYPIVSAENAEEKVIAVYNFGQYVKIACEKGKRCFVVNATGR
SELIVELQTEPRSAELLDTFGRAVQTPVLKAGFARIPVPASGLMVLNF

Enzyme Prediction     

No EC number prediction in MGYG000000666_01668.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	5.51e-65	186	479	1	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.64e-10	188	332	2	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	3.30e-10	202	331	53	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06591	GH31_xylosidase_XylS	5.41e-09	210	415	27	240	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG3345	GalA	4.39e-07	173	349	273	468	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	6.65e-257	1	588	1	587
QGQ97599.1	1.25e-193	20	587	20	588
CQR57728.1	1.64e-192	15	587	15	588
AIQ68815.1	3.10e-188	1	587	1	590
QTH41069.1	3.20e-187	11	586	13	588

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ARP5	1.86e-06	192	331	331	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000054	0.000007	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_01668.