CAZyme Information: MGYG000000666_02123

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02123
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000000666_128|CGC1	44232.23	10.1606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 7785; End: 8975 Strand: -

Full Sequence      

MIPKRKEIWIIAGEASGDLYGARLATELRRRAPDAFIAGMGGIEMRKAGVEILVDSSELG
VIGLVEVLGNLFKFIHILLSLIREAKKRRPAAVVLVDYPGFNIRFARAMWKAGIPVVWYI
SPQVWVWRRGNIRKLAKYCRKLMVIFPFEPEVYEGSGLDVEFVGHPLVDIVQGRADSSIE
RDPNSILLLPGSRKKEIDFLLEPFLKTVSILKSRHPKLQFIVAAPREKILQMIREGIQEF
TRKHPDYPLPDIPLTRGKNAFWMQRCTAGLAASGTVTVECAIAGLPLVVAYRLNKLTFLL
ARLVIGKLFRGFFTMVNIILYRRAFEEFLQFQVVPEDLADAMERILPGGERRAEVETDMK
EMVKAISGGANGAVAKAAACVLAVVAEHPGNGEKTK

Enzyme Prediction     

No EC number prediction in MGYG000000666_02123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	365	9.3e-105	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.83e-120	8	362	4	355	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.79e-109	6	366	2	362	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.27e-83	8	365	1	357	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.45e-74	1	351	1	350	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.19e-42	53	344	42	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	1.96e-143	1	378	1	379
AVM45461.1	3.18e-134	5	389	11	396
QQG66459.1	5.52e-75	6	385	14	391
ADW17729.1	1.62e-73	6	388	9	390
ACH37867.1	1.44e-72	1	378	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.01e-48	8	377	9	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.85e-48	8	377	9	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	8.69e-66	6	385	4	378	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.72e-65	2	385	3	380	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q83DS5	5.59e-65	6	355	4	346	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	5.59e-65	6	355	4	346	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
A9KC41	2.19e-64	6	355	4	346	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
266	288
298	320