CAZyme Information: MGYG000000666_02288

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02288
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000000666_145|CGC1	63085.82	9.8061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 7537; End: 9189 Strand: +

Full Sequence      

MKKMLFLLLVLIVLAYLAPLGVRELFSPDETRYGEIGREMRVLNDWVVPHLNGVHYFEKP
VMGYWFFAAAQELFGENAFAVRFPCMLMTLLSAAALFFFSRRFSPGGVQDAFLTVFTFLL
MPLVFGLATASTLDPLFSCFLTIGMVLFYFAVSSSGWRKNAFLFACGAAFGAAFLTKGFL
AIVLPGLSIFVYLLWTRRYKELFLLPWVPLLGFLLISLPWAWAIHRAAPDFWPYFIYDEH
IKRFLEKEQHPEPFYFFVPVLLGGLGYLLFYLPTAVRGFRKTVFRDDFFRYNFCWIVLPF
LFLSASTGKLPTYILPCFAPIAVLFAAGFRKAFLEEGKVGAFNLACRIFGGAVLLAAIVL
AVIQLSNPEWALFNKAESWKWVSILLAAVVLAVFLHFAATEKKGWEKLAYLCIALIPVLF
LYPFIVPERIEARKTVASLLERVKPKVGKDVKLIAFRHPFHGVCWGFRREDVYLYRFGGE
LTRGLEFMNRQDRVLDIEETNEFIQKNRNRGGVLLVLPNKLYREDQGKLPKPRWVESNSK
DRKGYSAVFF

Enzyme Prediction     

No EC number prediction in MGYG000000666_02288.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	511	1.7e-110	0.9425925925925925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	3.67e-118	19	532	22	536	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.59e-42	20	463	25	470	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	6.65e-10	59	222	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.36e-09	19	235	19	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH42095.1	2.08e-121	1	517	1	524
QSH42096.1	1.01e-119	2	539	3	542
CBX27700.1	7.01e-106	2	541	6	553
BCL61706.1	1.73e-101	6	541	8	547
AVM46372.1	2.72e-94	10	485	9	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.78e-31	16	393	45	426	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	1.87e-93	6	517	8	519	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A8GDR9	6.95e-86	14	536	18	541	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
A8FRR0	3.01e-85	13	506	17	506	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
A1JPM4	7.82e-84	14	517	18	521	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
B4TBG8	9.42e-84	12	517	15	515	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.304247	0.692273	0.001290	0.000597	0.000643	0.000929

TMHMM  Annotations     

start	end
4	26
78	100
110	129
136	158
173	195
202	224
254	276
288	307
312	334
341	363
378	400
407	426