CAZyme Information: MGYG000000666_02372

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02372
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585	MGYG000000666_155|CGC1	66720.11	6.1154

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 3088; End: 4845 Strand: +

Full Sequence      

MRRIEIRKKEFLVDGRPTCFRSGSMHYFRIHPDLWMDRLVKLKQCGLNTVESYLPWNLHE
ETEGSFCFSGGLDVERYVGMASSLGLMVILRPGPYICSEWDFGGLPAWLLNKPGLRIRCS
NREYLDAVDRYFSVLLPRLRRLQWTEGGPVVLMQIENEYGSVGNDTRYLRHLYDFFRDSG
ITIPLFISDWGSATVMDSGSIPETLLTVNCPSHPGPFLDEMQKLRPETPEFVMELWSGVS
HRWNAPYLRHGTQDVVQDVEEMLQRGNSFNFYMFHGGTSFGFLNGALRMGDRFEPYLNSY
DTDALLDEAGNPTPKYFAVQKLIRRYCPDAETGAPAPSALRKFPSVEFTGSAELFDQLSA
LSEPIESVTPEPMERCGQNFGFILYRSSVSFREKSAPLSLRNLADEAWVYVDGKRYGSMV
CNRNDSVPVPPGRLDILVENQGRVNMAMGENDRWNKGLDGVLIQSRRLYSWEMYPLALKD
LSRLRFGPYNPSPAGPCFHRAEFVIGEVADTFIRIPCGTHGQLFLNGVNLGRYRVEGPQF
ALYAPAPLLKKGKNELIVFEVEGLRENRIEFLDHPDHAPFTEMIR

Enzyme Prediction     

No EC number prediction in MGYG000000666_02372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	11	324	5.8e-106	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.91e-127	10	324	1	316	Glycosyl hydrolases family 35.
COG1874	GanA	7.96e-48	11	563	8	592	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	1.78e-46	8	360	34	373	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	7.29e-06	33	160	10	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN39288.1	4.42e-177	1	579	1	588
QNK60278.1	5.13e-177	1	576	1	581
AUS98261.1	6.04e-175	1	576	1	578
QJD88406.1	1.89e-174	1	575	1	579
QMV42537.1	5.92e-173	6	576	6	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	8.39e-157	11	575	24	591	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	1.54e-135	1	575	1	585	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
6EON_A	2.55e-115	5	575	29	607	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	9.90e-112	5	575	9	587	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3WF3_A	4.54e-110	4	562	35	623	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5XIL5	1.13e-122	11	560	56	613	Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Glb1l3 PE=2 SV=1
P48982	3.41e-122	10	543	36	572	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
A2RSQ1	9.03e-120	8	560	53	613	Beta-galactosidase-1-like protein 3 OS=Mus musculus OX=10090 GN=Glb1l3 PE=1 SV=1
Q8IW92	3.84e-118	11	575	54	627	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1
Q8NCI6	8.69e-118	8	560	77	637	Beta-galactosidase-1-like protein 3 OS=Homo sapiens OX=9606 GN=GLB1L3 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_02372.